RetrogeneDB ID: | retro_mmus_450 | ||
Retrocopylocation | Organism: | Mouse (Mus musculus) | |
| Coordinates: | 1:64454361..64454577(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | Smim7 | ||
| Ensembl ID: | ENSMUSG00000044600 | ||
| Aliases: | Smim7, 9130011J15Rik | ||
| Description: | small integral membrane protein 7 [Source:MGI Symbol;Acc:MGI:1914068] |
| Percent Identity: | 61.84 % |
| Parental protein coverage: | 100. % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 0 |
| Parental | MIGDILLFGTLLMNAGAVLNFKLKKKD-TQGFGEESKEPSTGDNIREFLLSLRYFRIFIALWNVFMMLCM |
| MIGDILLF..LLMN.G........K.......GEE..EPSTGDNIREFL.SLRYFRIF..LWNVFM.... | |
| Retrocopy | MIGDILLFQMLLMNVGGCAQL*TEKEGHARLWGEELREPSTGDNIREFLVSLRYFRIFTTLWNVFM---- |
| Parental | IVLFGS |
| ..LFGS | |
| Retrocopy | VILFGS |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 63 .20 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 36 .60 RPM |
| SRP007412_heart | 0 .00 RPM | 60 .58 RPM |
| SRP007412_kidney | 0 .00 RPM | 48 .37 RPM |
| SRP007412_liver | 0 .00 RPM | 32 .22 RPM |
| SRP007412_testis | 0 .00 RPM | 11 .80 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Rattus norvegicus | retro_rnor_2694 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000010105 | 1 retrocopy | |
| Canis familiaris | ENSCAFG00000015643 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000013936 | 1 retrocopy | |
| Equus caballus | ENSECAG00000026861 | 1 retrocopy | |
| Felis catus | ENSFCAG00000016411 | 1 retrocopy | |
| Homo sapiens | ENSG00000214046 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000044600 | 1 retrocopy |
retro_mmus_450 ,
|
| Nomascus leucogenys | ENSNLEG00000005569 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000009694 | 2 retrocopies | |
| Pan troglodytes | ENSPTRG00000010650 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000042037 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000013863 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000009556 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000015020 | 2 retrocopies | |
| Vicugna pacos | ENSVPAG00000006699 | 1 retrocopy |