RetrogeneDB ID: | retro_nleu_1315 | ||
Retrocopylocation | Organism: | Gibbon (Nomascus leucogenys) | |
| Coordinates: | GL397288.1:14770402..14770618(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | C19ORF42 | ||
| Ensembl ID: | ENSNLEG00000005569 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 84.72 % |
| Parental protein coverage: | 71.29 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 0 |
| Parental | MIGDILLFGTLLMNAGAVLNFKLKKKDTQGFGEESREPSTGDNIREFLLSLRYFRIFIALWNIFMMFCMI |
| MIGDILLFGTLLMNAGAVLNFKLKKKDTQGFG.E..EPST.DNIREFLLSLRYF.IF..LWN.F.M.CM. | |
| Retrocopy | MIGDILLFGTLLMNAGAVLNFKLKKKDTQGFGKEAWEPSTSDNIREFLLSLRYF*IFTILWNVFIMCCMT |
| Parental | VL |
| VL | |
| Retrocopy | VL |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000010105 | 1 retrocopy | |
| Canis familiaris | ENSCAFG00000015643 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000013936 | 1 retrocopy | |
| Equus caballus | ENSECAG00000026861 | 1 retrocopy | |
| Felis catus | ENSFCAG00000016411 | 1 retrocopy | |
| Homo sapiens | ENSG00000214046 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000044600 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000005569 | 1 retrocopy |
retro_nleu_1315 ,
|
| Pongo abelii | ENSPPYG00000009694 | 2 retrocopies | |
| Pan troglodytes | ENSPTRG00000010650 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000042037 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000013863 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000009556 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000015020 | 2 retrocopies | |
| Vicugna pacos | ENSVPAG00000006699 | 1 retrocopy |