RetrogeneDB ID: | retro_sscr_634 | ||
Retrocopylocation | Organism: | Pig (Sus scrofa) | |
| Coordinates: | 2:113985655..113986012(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | RALA | ||
| Ensembl ID: | ENSSSCG00000029741 | ||
| Aliases: | None | ||
| Description: | v-ral simian leukemia viral oncogene homolog A (ras related) [Source:HGNC Symbol;Acc:9839] |
| Percent Identity: | 65.04 % |
| Parental protein coverage: | 58.25 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected | 3 |
| Parental | VQIDILDTAGQEDYAAIRDNYFRSGE-GF-LCVFSITELESFAATADFR-EQILRVKEDENVPFLLVGNK |
| ....I....G.EDYAA..DNYF..GE.GF...V..ITE.ESFAATA.FR.E..LR.KED.NV.F..VG.K | |
| Retrocopy | IAVFIPESPGLEDYAAVKDNYFQNGE<GF<SAVSTITEIESFAATAGFR<EHMLRIKEDKNV*FSPVGYK |
| Parental | SDLEDKRQVSVEEAKTRADQWNVNYVETSAKTRANVDKVFFDLMREIRARKME |
| SDL.DK..V.VEEAKTRA.QWNVNYVETSAK...NV.KV.FDLMRE...RKME | |
| Retrocopy | SDLGDKSKVYVEEAKTRANQWNVNYVETSAKM*TNVNKVMFDLMREFQVRKME |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP014902_placenta | 0 .00 RPM | 83 .62 RPM |
| SRP014902_testis | 0 .00 RPM | 73 .98 RPM |
| SRP018288_heart | 0 .00 RPM | 33 .87 RPM |
| SRP018288_kidney | 0 .00 RPM | 42 .65 RPM |
| SRP018288_liver | 0 .00 RPM | 22 .39 RPM |
| SRP018288_lung | 0 .00 RPM | 48 .98 RPM |
| SRP018856_adipose | 0 .00 RPM | 44 .59 RPM |
| SRP035408_brain | 0 .00 RPM | 143 .91 RPM |
| SRP035408_liver | 0 .00 RPM | 63 .41 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000007630 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000017413 | 1 retrocopy | |
| Homo sapiens | ENSG00000006451 | 2 retrocopies | |
| Macropus eugenii | ENSMEUG00000000259 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000016059 | 2 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000003055 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000017619 | 3 retrocopies | |
| Pan troglodytes | ENSPTRG00000019108 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000006753 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000021148 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000029741 | 1 retrocopy |
retro_sscr_634 ,
|
| Sus scrofa | ENSSSCG00000030014 | 2 retrocopies | |
| Ictidomys tridecemlineatus | ENSSTOG00000020292 | 2 retrocopies | |
| Vicugna pacos | ENSVPAG00000002810 | 1 retrocopy |