RetrogeneDB ID: | retro_ptro_2511 | ||
Retrocopylocation | Organism: | Chimpanzee (Pan troglodytes) | |
| Coordinates: | 7:19203401..19203748(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | RALA | ||
| Ensembl ID: | ENSPTRG00000019108 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 82.35 % |
| Parental protein coverage: | 57.28 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected | 1 |
| Parental | FLCVFSITEMESFAATADFREQI-LRVKEDENVPFLLVGNKSDLEDKRQVSVEEAKNRAEQWNVNYVETS |
| F.CVFSITEMESFAAT.DF.EQI.LRVKE.EN.PFLLVGNKSDLEDKRQVS.EEAKNRA..WNV..VETS | |
| Retrocopy | FHCVFSITEMESFAATVDFKEQI<LRVKEEENIPFLLVGNKSDLEDKRQVSIEEAKNRAD*WNVICVETS |
| Parental | AKTRANVDKVFFDLMREIRARKMEDSKEKNGKKKRKSLAKRIRERCCIL |
| .KT.ANV.KVFFDLMREIR.RKME..KE...KKKRKSLAK.IRERCCIL | |
| Retrocopy | PKT*ANVHKVFFDLMREIRVRKMEGDKE--WKKKRKSLAKTIRERCCIL |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 33 .01 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 25 .56 RPM |
| SRP007412_heart | 0 .00 RPM | 18 .86 RPM |
| SRP007412_kidney | 0 .00 RPM | 27 .01 RPM |
| SRP007412_liver | 0 .00 RPM | 23 .57 RPM |
| SRP007412_testis | 0 .00 RPM | 24 .87 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_3707 |
| Pongo abelii | retro_pabe_3148 |
| Macaca mulatta | retro_mmul_1706 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000007630 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000017413 | 1 retrocopy | |
| Homo sapiens | ENSG00000006451 | 2 retrocopies | |
| Macropus eugenii | ENSMEUG00000000259 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000016059 | 2 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000003055 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000017619 | 3 retrocopies | |
| Pan troglodytes | ENSPTRG00000001102 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000005197 | 3 retrocopies | |
| Pan troglodytes | ENSPTRG00000019108 | 1 retrocopy |
retro_ptro_2511 ,
|
| Sus scrofa | ENSSSCG00000029741 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000020292 | 2 retrocopies | |
| Vicugna pacos | ENSVPAG00000002810 | 1 retrocopy |