RetrogeneDB ID: | retro_sscr_520 | ||
Retrocopylocation | Organism: | Pig (Sus scrofa) | |
| Coordinates: | 16:29671803..29672087(+) | ||
| Located in intron of: | ENSSSCG00000029546 | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | NRAS | ||
| Ensembl ID: | ENSSSCG00000006753 | ||
| Aliases: | NRAS, H-RAS, HRAS | ||
| Description: | Sus scrofa neuroblastoma RAS viral (v-ras) oncogene homolog (NRAS), mRNA. [Source:RefSeq mRNA;Acc:NM_001044537] |
| Percent Identity: | 70.83 % |
| Parental protein coverage: | 50.26 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected | 1 |
| Parental | GVGKSALTIQLIQNHFVDEYDPTIE-DSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCV |
| G.GKS..TI.LIQNHFVD.YDPT.E..SY.KQ.VI.GE.CLLDI.DTAGQEE.SA.RDQYMRT.EG...V | |
| Retrocopy | GGGKSTMTIPLIQNHFVDKYDPTTE<ESYPKQMVIRGEACLLDIPDTAGQEEHSAKRDQYMRTDEGLP*V |
| Parental | FAINNSKSFADINLYREQIKRVKDSD |
| FAIN..KSFA.IN.YR..I...KDSD | |
| Retrocopy | FAINKGKSFAHINPYRGEI*HIKDSD |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP014902_placenta | 0 .00 RPM | 16 .72 RPM |
| SRP014902_testis | 0 .00 RPM | 23 .34 RPM |
| SRP018288_heart | 0 .00 RPM | 12 .02 RPM |
| SRP018288_kidney | 0 .10 RPM | 29 .95 RPM |
| SRP018288_liver | 0 .16 RPM | 12 .15 RPM |
| SRP018288_lung | 0 .00 RPM | 27 .09 RPM |
| SRP018856_adipose | 0 .00 RPM | 32 .62 RPM |
| SRP035408_brain | 0 .00 RPM | 11 .75 RPM |
| SRP035408_liver | 0 .00 RPM | 16 .64 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000017134 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000036517 | 1 retrocopy | |
| Felis catus | ENSFCAG00000019026 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000020706 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000002675 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000022354 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000004590 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000022455 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000023079 | 2 retrocopies | |
| Sus scrofa | ENSSSCG00000006753 | 1 retrocopy |
retro_sscr_520 ,
|
| Sus scrofa | ENSSSCG00000021148 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000029741 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000030014 | 2 retrocopies |