RetrogeneDB ID: | retro_cjac_2400 | ||
Retrocopylocation | Organism: | Marmoset (Callithrix jacchus) | |
| Coordinates: | 4:2722664..2723099(-) | ||
| Located in intron of: | ENSCJAG00000010717 | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | NRAS | ||
| Ensembl ID: | ENSCJAG00000036517 | ||
| Aliases: | None | ||
| Description: | neuroblastoma RAS viral (v-ras) oncogene homolog [Source:HGNC Symbol;Acc:7989] |
| Percent Identity: | 75.17 % |
| Parental protein coverage: | 76.72 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 0 |
| Parental | FVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYR |
| F.DEYDPTIEDS.RKQVV.DGET.LL..L.TA.QEE.SAMRDQYM.TGEGFLC....NNSKSF.DINLYR | |
| Retrocopy | FADEYDPTIEDS*RKQVVSDGETRLLNTLHTARQEESSAMRDQYMGTGEGFLCALTNNNSKSFVDINLYR |
| Parental | EQIKRVKDSDDVPMVLVGNKCDLPTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYR |
| EQIK.VKDSD.VP.VL.G.KCD.PT.TVDTKQ.H.LAKSY.IP...TSAKTRQ.VEDA.YTL.RE..QY. | |
| Retrocopy | EQIKQVKDSDYVPLVLAGSKCDMPTSTVDTKQGHKLAKSYSIPLTKTSAKTRQAVEDALYTLLREVHQYQ |
| Parental | MKKLH |
| MK.L. | |
| Retrocopy | MKNLN |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP051959_colon | 1 .09 RPM | 27 .65 RPM |
| SRP051959_heart | 0 .74 RPM | 26 .71 RPM |
| SRP051959_kidney | 0 .89 RPM | 29 .57 RPM |
| SRP051959_liver | 0 .11 RPM | 18 .91 RPM |
| SRP051959_lung | 1 .40 RPM | 29 .90 RPM |
| SRP051959_lymph_node | 0 .14 RPM | 28 .67 RPM |
| SRP051959_skeletal_muscle | 0 .09 RPM | 45 .64 RPM |
| SRP051959_spleen | 0 .48 RPM | 27 .37 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000017134 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000007261 | 3 retrocopies | |
| Callithrix jacchus | ENSCJAG00000007630 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000013392 | 7 retrocopies | |
| Callithrix jacchus | ENSCJAG00000036517 | 1 retrocopy |
retro_cjac_2400 ,
|
| Felis catus | ENSFCAG00000019026 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000020706 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000002675 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000022354 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000004590 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000022455 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000023079 | 2 retrocopies | |
| Sus scrofa | ENSSSCG00000006753 | 1 retrocopy |