RetrogeneDB ID: | retro_sscr_241 | ||
Retrocopylocation | Organism: | Pig (Sus scrofa) | |
| Coordinates: | 10:18129163..18129492(-) | ||
| Located in intron of: | ENSSSCG00000010872 | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | MPC2 | ||
| Ensembl ID: | ENSSSCG00000006304 | ||
| Aliases: | MPC2, BRP44 | ||
| Description: | mitochondrial pyruvate carrier 2 [Source:HGNC Symbol;Acc:24515] |
| Percent Identity: | 52.68 % |
| Parental protein coverage: | 86.72 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 1 |
| Parental | MSAAGARGLRATYHRVLDKVELLLPEKLR-PLYNHPAGPRTVFFWAPIMKWGLVCAGLADMARPAEKLST |
| M.AA.A.GL.A.Y...L.K.E..L.EKLR..LYN.PA..R..FFWAPIM.WGLV.AGL.DM....EKL.T | |
| Retrocopy | MLAASAQGLQAIYQWALNKGEHPLTEKLR<ALYNQPADSRSLFFWAPIMTWGLVYAGLVDMPGLSEKLKT |
| Parental | AQSAVLMATAGFIWSRYSLVIIPKNWSLFAVNFFVGTAGASQ |
| .Q.A.LMA..GFIWSR..L.II..........F.V...G... | |
| Retrocopy | SQLAILMA-SGFIWSRHLLIIIXXXXXXXWILFAVNLLGQQE |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP014902_placenta | 0 .00 RPM | 22 .96 RPM |
| SRP014902_testis | 0 .00 RPM | 17 .96 RPM |
| SRP018288_heart | 0 .00 RPM | 162 .35 RPM |
| SRP018288_kidney | 0 .00 RPM | 106 .88 RPM |
| SRP018288_liver | 0 .00 RPM | 57 .89 RPM |
| SRP018288_lung | 0 .00 RPM | 23 .62 RPM |
| SRP018856_adipose | 0 .00 RPM | 160 .90 RPM |
| SRP035408_brain | 0 .00 RPM | 37 .00 RPM |
| SRP035408_liver | 0 .00 RPM | 61 .15 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000006273 | 2 retrocopies | |
| Bos taurus | ENSBTAG00000020968 | 2 retrocopies | |
| Canis familiaris | ENSCAFG00000015358 | 2 retrocopies | |
| Choloepus hoffmanni | ENSCHOG00000007752 | 6 retrocopies | |
| Callithrix jacchus | ENSCJAG00000016985 | 1 retrocopy | |
| Cavia porcellus | ENSCPOG00000003860 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000011180 | 1 retrocopy | |
| Microcebus murinus | ENSMICG00000011691 | 5 retrocopies | |
| Myotis lucifugus | ENSMLUG00000011873 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000010387 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000026568 | 3 retrocopies | |
| Otolemur garnettii | ENSOGAG00000003130 | 3 retrocopies | |
| Sus scrofa | ENSSSCG00000006304 | 1 retrocopy |
retro_sscr_241 ,
|
| Tupaia belangeri | ENSTBEG00000014189 | 9 retrocopies | |
| Tarsius syrichta | ENSTSYG00000010251 | 3 retrocopies | |
| Tursiops truncatus | ENSTTRG00000008566 | 1 retrocopy | |
| Vicugna pacos | ENSVPAG00000010556 | 1 retrocopy |