RetrogeneDB ID: | retro_chof_23 | ||
Retrocopylocation | Organism: | Sloth (Choloepus hoffmanni) | |
| Coordinates: | scaffold_162523:268..502(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | ENSCHOG00000010857 | |
| Aliases: | None | ||
| Status: | KNOWN_PROTEIN_CODING | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSCHOG00000007752 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 97.4 % |
| Parental protein coverage: | 60.63 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 0 |
| Parental | GLVCAGLADMARPAEKLSTAQSAVLMATGFIWSRYSLVIIPKNWSLFAVNFFVGAAGTSQLFRIWRYNQE |
| GLVCAGLADMARPAEKLSTAQSAVLMATGFIWSRYSLV.IPKNWSLFAVNFF.GAAGTSQLFRIWRYNQE | |
| Retrocopy | GLVCAGLADMARPAEKLSTAQSAVLMATGFIWSRYSLVVIPKNWSLFAVNFFAGAAGTSQLFRIWRYNQE |
| Parental | LKAKANK |
| LKAKANK | |
| Retrocopy | LKAKANK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000006273 | 2 retrocopies | |
| Bos taurus | ENSBTAG00000020968 | 2 retrocopies | |
| Canis familiaris | ENSCAFG00000015358 | 2 retrocopies | |
| Choloepus hoffmanni | ENSCHOG00000007752 | 6 retrocopies | |
| Callithrix jacchus | ENSCJAG00000016985 | 1 retrocopy | |
| Cavia porcellus | ENSCPOG00000003860 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000011180 | 1 retrocopy | |
| Microcebus murinus | ENSMICG00000011691 | 5 retrocopies | |
| Myotis lucifugus | ENSMLUG00000011873 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000010387 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000026568 | 3 retrocopies | |
| Otolemur garnettii | ENSOGAG00000003130 | 3 retrocopies | |
| Sus scrofa | ENSSSCG00000006304 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000014189 | 9 retrocopies | |
| Tarsius syrichta | ENSTSYG00000010251 | 3 retrocopies | |
| Tursiops truncatus | ENSTTRG00000008566 | 1 retrocopy | |
| Vicugna pacos | ENSVPAG00000010556 | 1 retrocopy |