RetrogeneDB ID: | retro_mmus_647 | ||
Retrocopylocation | Organism: | Mouse (Mus musculus) | |
| Coordinates: | 10:56829085..56829304(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | Mpc2 | ||
| Ensembl ID: | ENSMUSG00000026568 | ||
| Aliases: | Mpc2, 0610006C01Rik, 2010002I07Rik, 2610205H19Rik, AA108335, Brp44, ESTM43 | ||
| Description: | mitochondrial pyruvate carrier 2 [Source:MGI Symbol;Acc:MGI:1917706] |
| Percent Identity: | 88. % |
| Parental protein coverage: | 59.06 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 0 |
| Parental | VCAGLADMARPAEKLSTAQSTVLMATGFIWSRYSLVIIPKNWSLFAVNFFVGSAGASQLFRIWRYNQELK |
| ..AGLADMAR.AEKLSTAQSTVL..TGFIWSRYSLVIIPKNWSLF.VNFFVGSAG.SQLF.IW.YNQELK | |
| Retrocopy | ISAGLADMARAAEKLSTAQSTVL--TGFIWSRYSLVIIPKNWSLFDVNFFVGSAGGSQLFWIWGYNQELK |
| Parental | SKGIQ |
| SKGIQ | |
| Retrocopy | SKGIQ |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 34 .37 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 22 .84 RPM |
| SRP007412_heart | 0 .00 RPM | 122 .28 RPM |
| SRP007412_kidney | 0 .04 RPM | 106 .05 RPM |
| SRP007412_liver | 0 .00 RPM | 97 .14 RPM |
| SRP007412_testis | 0 .00 RPM | 115 .31 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000006273 | 2 retrocopies | |
| Bos taurus | ENSBTAG00000020968 | 2 retrocopies | |
| Canis familiaris | ENSCAFG00000015358 | 2 retrocopies | |
| Choloepus hoffmanni | ENSCHOG00000007752 | 6 retrocopies | |
| Callithrix jacchus | ENSCJAG00000016985 | 1 retrocopy | |
| Cavia porcellus | ENSCPOG00000003860 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000011180 | 1 retrocopy | |
| Microcebus murinus | ENSMICG00000011691 | 5 retrocopies | |
| Myotis lucifugus | ENSMLUG00000011873 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000010387 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000026568 | 3 retrocopies |
retro_mmus_1651, retro_mmus_578, retro_mmus_647 ,
|
| Otolemur garnettii | ENSOGAG00000003130 | 3 retrocopies | |
| Sus scrofa | ENSSSCG00000006304 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000014189 | 9 retrocopies | |
| Tarsius syrichta | ENSTSYG00000010251 | 3 retrocopies | |
| Tursiops truncatus | ENSTTRG00000008566 | 1 retrocopy | |
| Vicugna pacos | ENSVPAG00000010556 | 1 retrocopy |