RetrogeneDB ID: | retro_rnor_2305 | ||
Retrocopylocation | Organism: | Rat (Rattus norvegicus) | |
| Coordinates: | 6:89541179..89541538(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | Prelid1 | ||
| Ensembl ID: | ENSRNOG00000016410 | ||
| Aliases: | Prelid1, Preli, RGD1308082 | ||
| Description: | PRELI domain-containing protein 1, mitochondrial [Source:RefSeq peptide;Acc:NP_001009636] |
| Percent Identity: | 64.23 % |
| Parental protein coverage: | 56.22 % |
| Number of stop codons detected: | 3 |
| Number of frameshifts detected | 1 |
| Parental | REVTPDQKLLSRRLLTKTNRMPRWAERLFPANVAHSVYILEDSIVDPQNQTMTTFTWNINHARLMVVEER |
| .EVTPD..LLSRRL.TKTNRM..W.ER.FPAN..H..YILEDSIV..QN...TT.T.N..H....V.EER | |
| Retrocopy | QEVTPDWNLLSRRLQTKTNRMVHWVERMFPANITHLMYILEDSIVESQNH-ITTVT*NHTHPADGV-EER |
| Parental | CVYCVNSDNSGWTEIRREAWVSSSLFGVSRAVQEFGL-ARFKSNVTKTMKGFE |
| CV.CVNS.....T....EA..SSSL.G.SRAVQEFGL.A.FKSNV.KTMK.FE | |
| Retrocopy | CVHCVNS*Q*PLTQNPQEASASSSLCGISRAVQEFGL<AHFKSNVAKTMKSFE |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 76 .28 RPM |
| SRP017611_kidney | 0 .00 RPM | 141 .10 RPM |
| SRP017611_liver | 0 .00 RPM | 87 .48 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Choloepus hoffmanni | ENSCHOG00000002251 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000006953 | 5 retrocopies | |
| Cavia porcellus | ENSCPOG00000025788 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000017550 | 1 retrocopy | |
| Equus caballus | ENSECAG00000023460 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000011762 | 3 retrocopies | |
| Macropus eugenii | ENSMEUG00000001738 | 12 retrocopies | |
| Myotis lucifugus | ENSMLUG00000007008 | 2 retrocopies | |
| Macaca mulatta | ENSMMUG00000009046 | 2 retrocopies | |
| Monodelphis domestica | ENSMODG00000004804 | 3 retrocopies | |
| Mus musculus | ENSMUSG00000021486 | 7 retrocopies | |
| Otolemur garnettii | ENSOGAG00000011455 | 4 retrocopies | |
| Rattus norvegicus | ENSRNOG00000016410 | 8 retrocopies |
retro_rnor_1138, retro_rnor_1166, retro_rnor_1243, retro_rnor_1906, retro_rnor_2178, retro_rnor_2305 , retro_rnor_637, retro_rnor_995,
|