RetrogeneDB ID: | retro_mmus_449 | ||
Retrocopylocation | Organism: | Mouse (Mus musculus) | |
| Coordinates: | 1:63364942..63365365(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | ENSMUSG00000081643 | |
| Aliases: | None | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | Prelid1 | ||
| Ensembl ID: | ENSMUSG00000021486 | ||
| Aliases: | Prelid1, 2610524G07Rik, Preli | ||
| Description: | PRELI domain containing 1 [Source:MGI Symbol;Acc:MGI:1913744] |
| Percent Identity: | 95.14 % |
| Parental protein coverage: | 66.36 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 0 |
| Parental | MVKYFLGQSVLRSSWDQVFAAFWQRYPNPYSKHVLTEDIVHREVTPDQKLLSRRLLTKTNRMPRWAERLF |
| MVKYFLGQSVLRSSWDQ.FAAFWQRYPNPYSKHVLTEDIVHREVTPDQKLLSRRLLTKTNRMPRWAE.LF | |
| Retrocopy | MVKYFLGQSVLRSSWDQLFAAFWQRYPNPYSKHVLTEDIVHREVTPDQKLLSRRLLTKTNRMPRWAE*LF |
| Parental | PANVAHSVYILEDSIVDPQNQTMTTFTWNINHARLMVVEERCVYCVNSDNSGWTEIRREAWVSSSLFGVS |
| PANVAHSVYILEDSIVDPQNQTMTTFTWNINHA.LMVVEERC.YCVNSDNSGWTEIRREA...SSLFGVS | |
| Retrocopy | PANVAHSVYILEDSIVDPQNQTMTTFTWNINHAQLMVVEERCIYCVNSDNSGWTEIRREA---SSLFGVS |
| Parental | RAVQ |
| RAVQ | |
| Retrocopy | RAVQ |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 36 .96 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 29 .44 RPM |
| SRP007412_heart | 0 .00 RPM | 12 .86 RPM |
| SRP007412_kidney | 0 .02 RPM | 53 .88 RPM |
| SRP007412_liver | 0 .03 RPM | 55 .19 RPM |
| SRP007412_testis | 0 .00 RPM | 7 .91 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Choloepus hoffmanni | ENSCHOG00000002251 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000006953 | 5 retrocopies | |
| Cavia porcellus | ENSCPOG00000025788 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000017550 | 1 retrocopy | |
| Equus caballus | ENSECAG00000023460 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000011762 | 3 retrocopies | |
| Macropus eugenii | ENSMEUG00000001738 | 12 retrocopies | |
| Myotis lucifugus | ENSMLUG00000007008 | 2 retrocopies | |
| Macaca mulatta | ENSMMUG00000009046 | 2 retrocopies | |
| Monodelphis domestica | ENSMODG00000004804 | 3 retrocopies | |
| Mus musculus | ENSMUSG00000021486 | 7 retrocopies |
retro_mmus_1316, retro_mmus_2079, retro_mmus_2236, retro_mmus_2394, retro_mmus_2672, retro_mmus_449 , retro_mmus_866,
|
| Otolemur garnettii | ENSOGAG00000011455 | 4 retrocopies | |
| Rattus norvegicus | ENSRNOG00000016410 | 8 retrocopies |