RetrogeneDB ID: | retro_rnor_1819 | ||
Retrocopylocation | Organism: | Rat (Rattus norvegicus) | |
| Coordinates: | 3:118668109..118668310(+) | ||
| Located in intron of: | ENSRNOG00000008316 | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | Sepw1 | ||
| Ensembl ID: | ENSRNOG00000013548 | ||
| Aliases: | None | ||
| Description: | selenoprotein W [Source:RefSeq peptide;Acc:NP_037159] |
| Percent Identity: | 55.71 % |
| Parental protein coverage: | 75.27 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 0 |
| Parental | KYLQLKEKLEHEFPGCLDICGEGTPQVTGFFEVTVAGKLVHSKKRGDGYVDTESKFRKLVTAIKAALAQC |
| ..L..K.KLE.E.P.CLD.CGE.......FF...V.GKLVHSKKRG.......S.F.KLVTA.KA.LAQC | |
| Retrocopy | RLLCVKGKLEDELPMCLDMCGE---RPSRFFQMAVDGKLVHSKKRGGSNLGI*SRFQKLVTATKATLAQC |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 100 .37 RPM |
| SRP017611_kidney | 0 .00 RPM | 3 .14 RPM |
| SRP017611_liver | 0 .07 RPM | 3 .23 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000015208 | 1 retrocopy | |
| Bos taurus | ENSBTAG00000008203 | 2 retrocopies | |
| Canis familiaris | ENSCAFG00000004074 | 1 retrocopy | |
| Choloepus hoffmanni | ENSCHOG00000013206 | 2 retrocopies | |
| Felis catus | ENSFCAG00000015176 | 2 retrocopies | |
| Mustela putorius furo | ENSMPUG00000004433 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000013548 | 2 retrocopies |
retro_rnor_1819 , retro_rnor_688,
|
| Ictidomys tridecemlineatus | ENSSTOG00000001294 | 1 retrocopy |