RetrogeneDB ID: | retro_btau_1527 | ||
Retrocopylocation | Organism: | Cow (Bos taurus) | |
| Coordinates: | 7:32166983..32167193(+) | ||
| Located in intron of: | ENSBTAG00000031069 | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | SEPW1 | ||
| Ensembl ID: | ENSBTAG00000008203 | ||
| Aliases: | None | ||
| Description: | selenoprotein W [Source:RefSeq peptide;Acc:NP_001156697] |
| Percent Identity: | 87.14 % |
| Parental protein coverage: | 94.59 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 0 |
| Parental | KYLQLKKKLEDEFPSRLDICGEGTPQVTGFFEVFVAGKLVHSKKGGDGYVDTESKFLKLVAAIKAALAQA |
| KYLQLKKKLED.FP..LDIC..GT.QVTGFFEVFVAGK.VHSKKGGDGY.D.ESKFLKLVAAIKAALAQA | |
| Retrocopy | KYLQLKKKLEDGFPGCLDICSKGTHQVTGFFEVFVAGKPVHSKKGGDGYMDMESKFLKLVAAIKAALAQA |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| ERP005899_liver | 0 .07 RPM | 9 .59 RPM |
| ERP005899_muscle | 0 .00 RPM | 69 .00 RPM |
| SRP017611_brain | 0 .05 RPM | 186 .55 RPM |
| SRP017611_kidney | 0 .00 RPM | 72 .73 RPM |
| SRP017611_liver | 0 .00 RPM | 27 .86 RPM |
| SRP030211_testis | 0 .00 RPM | 40 .32 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000015208 | 1 retrocopy | |
| Bos taurus | ENSBTAG00000008203 | 2 retrocopies |
retro_btau_1527 , retro_btau_756,
|
| Canis familiaris | ENSCAFG00000004074 | 1 retrocopy | |
| Choloepus hoffmanni | ENSCHOG00000013206 | 2 retrocopies | |
| Felis catus | ENSFCAG00000015176 | 2 retrocopies | |
| Mustela putorius furo | ENSMPUG00000004433 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000013548 | 2 retrocopies | |
| Ictidomys tridecemlineatus | ENSSTOG00000001294 | 1 retrocopy |