RetrogeneDB ID: | retro_amel_1135 | ||
Retrocopylocation | Organism: | Panda (Ailuropoda melanoleuca) | |
| Coordinates: | GL192942.1:501210..501456(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | SEPW1 | ||
| Ensembl ID: | ENSAMEG00000015208 | ||
| Aliases: | None | ||
| Description: | selenoprotein W, 1 [Source:HGNC Symbol;Acc:10752] |
| Percent Identity: | 80.49 % |
| Parental protein coverage: | 94.25 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected | 0 |
| Parental | RVVYWGWWGYKSKYLQLKKKLEDEFPGCLDICGEGTPQATGFFEVMVAGKLVHSKKRGDGYVDTESKFLK |
| ..VY.G..GYKSK.LQLK.KLEDEFP.CLDI.GE.TP.A.GFFEVMVAGKLVHSKKRGDGY.DTESKFLK | |
| Retrocopy | QIVYCGT*GYKSKHLQLKRKLEDEFPRCLDIYGERTP*AIGFFEVMVAGKLVHSKKRGDGYMDTESKFLK |
| Parental | LVAAIKAALAQG |
| L.A.IKA.LAQG | |
| Retrocopy | LLATIKATLAQG |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000015208 | 1 retrocopy |
retro_amel_1135 ,
|
| Bos taurus | ENSBTAG00000008203 | 2 retrocopies | |
| Canis familiaris | ENSCAFG00000004074 | 1 retrocopy | |
| Choloepus hoffmanni | ENSCHOG00000013206 | 2 retrocopies | |
| Felis catus | ENSFCAG00000015176 | 2 retrocopies | |
| Mustela putorius furo | ENSMPUG00000004433 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000013548 | 2 retrocopies | |
| Ictidomys tridecemlineatus | ENSSTOG00000001294 | 1 retrocopy |