RetrogeneDB ID: | retro_pabe_2630 | ||
Retrocopylocation | Organism: | Orangutan (Pongo abelii) | |
| Coordinates: | 5:38061059..38061331(+) | ||
| Located in intron of: | ENSPPYG00000015405 | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSPPYG00000029910 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 81.72 % |
| Parental protein coverage: | 92. % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 1 |
| Parental | MAKNKLRGPKSRNVFHIASQKNFKAKNKAKPVTTNLKKINIMNEEK-VNRVNKAFVNVQKELAHFSKSTS |
| MAKNKLRG.KSRNVFH..SQ.NFKAKNKAKPVTTNLK.INIMN.EK.VN.VN.AFVN.QKEL..FSK..S | |
| Retrocopy | MAKNKLRGQKSRNVFHMVSQNNFKAKNKAKPVTTNLK-INIMNDEK<VNNVNEAFVNIQKELDNFSKALS |
| Parental | LEPLQKELIPQQRHESKPVNVDE |
| LEPLQKE.IPQ.R.ESKPVNVDE | |
| Retrocopy | LEPLQKEPIPQKRPESKPVNVDE |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 1 .33 RPM |
| SRP007412_cerebellum | 0 .12 RPM | 3 .77 RPM |
| SRP007412_heart | 0 .03 RPM | 5 .24 RPM |
| SRP007412_kidney | 0 .00 RPM | 7 .96 RPM |
| SRP007412_liver | 0 .00 RPM | 7 .80 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_3163 |
| Pan troglodytes | retro_ptro_2275 |
| Gorilla gorilla | retro_ggor_1353 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000002409 | 2 retrocopies | |
| Bos taurus | ENSBTAG00000032227 | 2 retrocopies | |
| Callithrix jacchus | ENSCJAG00000000379 | 5 retrocopies | |
| Cavia porcellus | ENSCPOG00000021965 | 5 retrocopies | |
| Felis catus | ENSFCAG00000026366 | 1 retrocopy | |
| Homo sapiens | ENSG00000176731 | 4 retrocopies | |
| Gorilla gorilla | ENSGGOG00000027464 | 4 retrocopies | |
| Loxodonta africana | ENSLAFG00000032612 | 4 retrocopies | |
| Myotis lucifugus | ENSMLUG00000006155 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000006381 | 3 retrocopies | |
| Mus musculus | ENSMUSG00000078784 | 3 retrocopies | |
| Pongo abelii | ENSPPYG00000029910 | 3 retrocopies |
retro_pabe_2345, retro_pabe_2630 , retro_pabe_3633,
|
| Pan troglodytes | ENSPTRG00000020385 | 5 retrocopies | |
| Rattus norvegicus | ENSRNOG00000038902 | 2 retrocopies | |
| Sus scrofa | ENSSSCG00000006144 | 2 retrocopies |