RetrogeneDB ID: | retro_mmul_2490 | ||
Retrocopylocation | Organism: | Rhesus macaque (Macaca mulatta) | |
| Coordinates: | X:40283335..40283562(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | C8H8orf59 | ||
| Ensembl ID: | ENSMMUG00000006381 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 72.15 % |
| Parental protein coverage: | 78. % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 1 |
| Parental | FKAKNKAKPVTTNLKKINIMNDEKVNRVNKAFVNVQKELAHFSKGPSVEPLQKELIPQQ-RHESKPVNVD |
| FK.KNKAKPVTTN.K.IN.MNDEKV..V.KA.V..QKELA.FSKG.S.EPLQ.ELIPQQ..H..K..NVD | |
| Retrocopy | FKTKNKAKPVTTNIKRIN-MNDEKV-KVSKALVSIQKELACFSKGLSFEPLQNELIPQQ<GH*RKSSNVD |
| Parental | EATKLMALL |
| EAT.LMA.L | |
| Retrocopy | EATELMAHL |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 3 .59 RPM |
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 3 .33 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 3 .87 RPM |
| SRP007412_heart | 0 .00 RPM | 4 .65 RPM |
| SRP007412_kidney | 0 .00 RPM | 5 .99 RPM |
| SRP007412_liver | 0 .00 RPM | 2 .22 RPM |
| SRP007412_testis | 0 .00 RPM | 4 .07 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Pongo abelii | retro_pabe_3633 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000002409 | 2 retrocopies | |
| Bos taurus | ENSBTAG00000032227 | 2 retrocopies | |
| Callithrix jacchus | ENSCJAG00000000379 | 5 retrocopies | |
| Cavia porcellus | ENSCPOG00000021965 | 5 retrocopies | |
| Felis catus | ENSFCAG00000026366 | 1 retrocopy | |
| Homo sapiens | ENSG00000176731 | 4 retrocopies | |
| Gorilla gorilla | ENSGGOG00000027464 | 4 retrocopies | |
| Loxodonta africana | ENSLAFG00000032612 | 4 retrocopies | |
| Myotis lucifugus | ENSMLUG00000006155 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000006381 | 3 retrocopies |
retro_mmul_1475, retro_mmul_2490 , retro_mmul_537,
|
| Mus musculus | ENSMUSG00000078784 | 3 retrocopies | |
| Pongo abelii | ENSPPYG00000029910 | 3 retrocopies | |
| Pan troglodytes | ENSPTRG00000020385 | 5 retrocopies | |
| Rattus norvegicus | ENSRNOG00000038902 | 2 retrocopies | |
| Sus scrofa | ENSSSCG00000006144 | 2 retrocopies |