RetrogeneDB ID: | retro_mputfur_1028 | ||
Retrocopylocation | Organism: | Ferret (Mustela putorius furo) | |
| Coordinates: | GL896997.1:3561012..3561254(-) | ||
| Located in intron of: | ENSMPUG00000002070 | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | Gm2178 | ||
| Ensembl ID: | ENSMPUG00000008873 | ||
| Aliases: | None | ||
| Description: | predicted gene 2178 [Source:MGI Symbol;Acc:MGI:3780348] |
| Percent Identity: | 71.08 % |
| Parental protein coverage: | 66.39 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 1 |
| Parental | KAFRMVQRLTY-RRRLSYNTASNKT-RLSRTPGNRIVYLYTKKVGKAPKSACGVCPGRLRGVRAVRPKVL |
| .AFRM.Q.LT..R.RL.Y.TAS..T.RLS..PGNRIVYL...KVGKAPK...GVCPG.L.GVRA.RPKVL | |
| Retrocopy | EAFRMAQCLTH<RPRLPYSTASDQTLRLSLSPGNRIVYLF-EKVGKAPKTTRGVCPGQLQGVRAGRPKVL |
| Parental | MRLSKTKKHVSRA |
| .RL.KTKKHVSRA | |
| Retrocopy | RRLFKTKKHVSRA |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |