RetrogeneDB ID: | retro_cpor_402 | ||
Retrocopylocation | Organism: | Guinea Pig (Cavia porcellus) | |
| Coordinates: | scaffold_14:40748460..40748679(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | RPL34 | ||
| Ensembl ID: | ENSCPOG00000000802 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 58.67 % |
| Parental protein coverage: | 64.1 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 0 |
| Parental | MVQRLTYRRRLSYNTASNKTRLSRTPGNRIVYLYTKKVGKAPKSACGVCPGRLRGVRAVRPKVLMRLSKT |
| ..Q.LT...RLS..T.SNKTRLS.TPGNRIV.L.T..VGK.P.SACGV.........AVRPKVL.R.S.. | |
| Retrocopy | VAQHLT*HARLSFSTVSNKTRLSSTPGNRIVHLDT-RVGKTPESACGV-SSQTAWANAVRPKVLKRFSEM |
| Parental | KKHVS |
| K..VS | |
| Retrocopy | KELVS |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .29 RPM | 90 .42 RPM |
| SRP017611_kidney | 0 .21 RPM | 142 .90 RPM |
| SRP017611_liver | 0 .04 RPM | 86 .97 RPM |
| SRP040447_lung | 0 .10 RPM | 189 .84 RPM |
| SRP040447_skeletal_muscle | 0 .01 RPM | 148 .17 RPM |