RetrogeneDB ID: | retro_sara_538 | ||
Retrocopylocation | Organism: | Shrew (Sorex araneus) | |
| Coordinates: | scaffold_231878:20950..21181(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | RPL34 | ||
| Ensembl ID: | ENSSARG00000000177 | ||
| Aliases: | None | ||
| Description: | ribosomal protein L34 [Source:HGNC Symbol;Acc:10340] |
| Percent Identity: | 53.25 % |
| Parental protein coverage: | 81.05 % |
| Number of stop codons detected: | 6 |
| Number of frameshifts detected | 0 |
| Parental | KAPKSACGVCPGRLRGVRAVRPKVLKRLSKTKKHVSRAYGGSMCAKCVRDRIKRAFLIEEQKIVVKVLKA |
| .AP.SAC...P..L....AV..K.L......KK.VSR....SM.AKCV.D....AFLIEEQ.I..KVLKA | |
| Retrocopy | EAPISACSMYPVLL*RI*AVKSKFL*GIYHEKK*VSRT*SSSM*AKCVCDMVSCAFLIEEQNIIMKVLKA |
| Parental | QAQSQKA |
| QAQS.K. | |
| Retrocopy | QAQSVKS |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |