RetrogeneDB ID: | retro_mmus_1216 | ||
Retrocopylocation | Organism: | Mouse (Mus musculus) | |
| Coordinates: | 14:68643549..68643741(+) | ||
| Located in intron of: | ENSMUSG00000014725 | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | Tma7 | ||
| Ensembl ID: | ENSMUSG00000091537 | ||
| Aliases: | Tma7, 1110017O22Rik, Ccdc72 | ||
| Description: | translational machinery associated 7 homolog (S. cerevisiae) [Source:MGI Symbol;Acc:MGI:1913417] |
| Percent Identity: | 90.62 % |
| Parental protein coverage: | 100. % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 0 |
| Parental | MSGREGGKKKPLKQPKKQAKEMDEEDKAFKQKQKEEQKKLEELKAKAAGKGPLATGGIKKSGKK |
| MSGREGGKKKPLKQP.KQAKEMDEEDKAFKQK.KEEQKKLEELKAKAA..G.LATGG.KKSGKK | |
| Retrocopy | MSGREGGKKKPLKQPEKQAKEMDEEDKAFKQK*KEEQKKLEELKAKAAEQGALATGGMKKSGKK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 10 .07 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 7 .08 RPM |
| SRP007412_heart | 0 .00 RPM | 17 .53 RPM |
| SRP007412_kidney | 0 .04 RPM | 15 .34 RPM |
| SRP007412_liver | 0 .00 RPM | 11 .03 RPM |
| SRP007412_testis | 0 .00 RPM | 15 .14 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000001193 | 6 retrocopies | |
| Callithrix jacchus | ENSCJAG00000002871 | 18 retrocopies |
retro_cjac_1370, retro_cjac_1449, retro_cjac_1504, retro_cjac_1667, retro_cjac_1670, retro_cjac_1704, retro_cjac_1918, retro_cjac_2092, retro_cjac_2258, retro_cjac_2422, retro_cjac_2629, retro_cjac_2673, retro_cjac_2692, retro_cjac_2799, retro_cjac_3651, retro_cjac_536, retro_cjac_81, retro_cjac_849,
|
| Felis catus | ENSFCAG00000026902 | 5 retrocopies | |
| Gorilla gorilla | ENSGGOG00000028044 | 3 retrocopies | |
| Mus musculus | ENSMUSG00000091537 | 11 retrocopies |
retro_mmus_1216 , retro_mmus_1582, retro_mmus_1632, retro_mmus_2117, retro_mmus_2189, retro_mmus_2222, retro_mmus_2545, retro_mmus_2975, retro_mmus_3235, retro_mmus_389, retro_mmus_412,
|
| Pan troglodytes | ENSPTRG00000041769 | 9 retrocopies | |
| Rattus norvegicus | ENSRNOG00000042689 | 2 retrocopies | |
| Rattus norvegicus | ENSRNOG00000047225 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000011351 | 6 retrocopies |