RetrogeneDB ID: | retro_cjac_2692 | ||
Retrocopylocation | Organism: | Marmoset (Callithrix jacchus) | |
| Coordinates: | 6:14671088..14671280(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | TMA7 | ||
| Ensembl ID: | ENSCJAG00000002871 | ||
| Aliases: | None | ||
| Description: | translation machinery associated 7 homolog (S. cerevisiae) [Source:HGNC Symbol;Acc:26932] |
| Percent Identity: | 89.06 % |
| Parental protein coverage: | 100. % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 0 |
| Parental | MSGREGGKKKPLKQPKKQAKEMDEEDKAFKQKQKEEQKKLEELKAKAAGKGPLATGGIKKSGKK |
| .SG.E.GKKKPLKQPKKQAKEMDEEDKAFKQKQKE..KKL.ELKAKAAGKGPLATGG.KKSGKK | |
| Retrocopy | ISGWEAGKKKPLKQPKKQAKEMDEEDKAFKQKQKEKRKKLKELKAKAAGKGPLATGGTKKSGKK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP051959_colon | 0 .00 RPM | 11 .36 RPM |
| SRP051959_heart | 0 .00 RPM | 11 .17 RPM |
| SRP051959_kidney | 0 .00 RPM | 14 .89 RPM |
| SRP051959_liver | 0 .00 RPM | 11 .61 RPM |
| SRP051959_lung | 0 .02 RPM | 13 .13 RPM |
| SRP051959_lymph_node | 0 .00 RPM | 13 .68 RPM |
| SRP051959_skeletal_muscle | 0 .02 RPM | 15 .53 RPM |
| SRP051959_spleen | 0 .00 RPM | 13 .82 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000001193 | 6 retrocopies | |
| Callithrix jacchus | ENSCJAG00000002871 | 18 retrocopies |
retro_cjac_1370, retro_cjac_1449, retro_cjac_1504, retro_cjac_1667, retro_cjac_1670, retro_cjac_1704, retro_cjac_1918, retro_cjac_2092, retro_cjac_2258, retro_cjac_2422, retro_cjac_2629, retro_cjac_2673, retro_cjac_2692 , retro_cjac_2799, retro_cjac_3651, retro_cjac_536, retro_cjac_81, retro_cjac_849,
|
| Felis catus | ENSFCAG00000026902 | 5 retrocopies | |
| Gorilla gorilla | ENSGGOG00000028044 | 3 retrocopies | |
| Mus musculus | ENSMUSG00000091537 | 11 retrocopies | |
| Pan troglodytes | ENSPTRG00000041769 | 9 retrocopies | |
| Rattus norvegicus | ENSRNOG00000042689 | 2 retrocopies | |
| Rattus norvegicus | ENSRNOG00000047225 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000011351 | 6 retrocopies |