RetrogeneDB ID: | retro_mmul_1290 | ||
Retrocopylocation | Organism: | Rhesus macaque (Macaca mulatta) | |
| Coordinates: | 17:53489944..53490386(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | MMU.1607 | ||
| Ensembl ID: | ENSMMUG00000016981 | ||
| Aliases: | None | ||
| Description: | 26S proteasome non-ATPase regulatory subunit 10 [Source:RefSeq peptide;Acc:NP_001248034] |
| Percent Identity: | 83.33 % |
| Parental protein coverage: | 65.49 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected | 2 |
| Parental | MEGCVSNLMVCNLAYSGKLEELKESILADKSLATRTDQDRRTA-LHWACSAGHTEIVEFLLQLGVPVNDK |
| M.GCVSNLMVCNLAY.GKLEE.KESILADKSL.T.TDQD.RTA..HWACSA.HT.IVEFLL.LGVPVNDK | |
| Retrocopy | M*GCVSNLMVCNLAYCGKLEEFKESILADKSLTTSTDQDSRTA<MHWACSAVHTGIVEFLLHLGVPVNDK |
| Parental | DDAGWSPL-HIAASAGRDEIVKALLGKGAQVNAVNQNGCTPLHYAASKNRHEIAVMLLEGGANPDAKDHY |
| .D.G.SPL.HIAASAG..EIVK.L.GKGAQVNAVNQNG.TPLHYAA.KNRHEIAVMLLEG.ANP.AKDHY | |
| Retrocopy | GDSG*SPL<HIAASAGWEEIVKTLVGKGAQVNAVNQNGYTPLHYAAFKNRHEIAVMLLEGRANPHAKDHY |
| Parental | EATAMHRAAA |
| EATA.H.AAA | |
| Retrocopy | EATALHWAAA |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 32 .94 RPM |
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 25 .07 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 27 .06 RPM |
| SRP007412_heart | 0 .00 RPM | 9 .95 RPM |
| SRP007412_kidney | 0 .00 RPM | 15 .96 RPM |
| SRP007412_liver | 0 .00 RPM | 10 .93 RPM |
| SRP007412_testis | 0 .00 RPM | 9 .20 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_1214 |
| Pan troglodytes | retro_ptro_831 |
| Gorilla gorilla | retro_ggor_945 |
| Pongo abelii | retro_pabe_1010 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Anolis carolinensis | ENSACAG00000012006 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000007717 | 1 retrocopy | |
| Cavia porcellus | ENSCPOG00000015068 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000001902 | 5 retrocopies | |
| Homo sapiens | ENSG00000101843 | 3 retrocopies | |
| Gorilla gorilla | ENSGGOG00000002969 | 3 retrocopies | |
| Microcebus murinus | ENSMICG00000002059 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000014534 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000015254 | 2 retrocopies | |
| Macaca mulatta | ENSMMUG00000016981 | 1 retrocopy |
retro_mmul_1290 ,
|
| Nomascus leucogenys | ENSNLEG00000014001 | 2 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000010837 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000006419 | 1 retrocopy | |
| Procavia capensis | ENSPCAG00000005221 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000020618 | 3 retrocopies | |
| Pan troglodytes | ENSPTRG00000022169 | 3 retrocopies | |
| Ictidomys tridecemlineatus | ENSSTOG00000003783 | 3 retrocopies | |
| Tarsius syrichta | ENSTSYG00000009920 | 13 retrocopies |