RetrogeneDB ID: | retro_dnov_660 | ||
Retrocopylocation | Organism: | Armadillo (Dasypus novemcinctus) | |
| Coordinates: | GeneScaffold_7397:167609..167901(-) | ||
| Located in intron of: | ENSDNOG00000024925 | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | PCBD2 | ||
| Ensembl ID: | ENSDNOG00000019125 | ||
| Aliases: | None | ||
| Description: | pterin-4 alpha-carbinolamine dehydratase/dimerization cofactor of hepatocyte nuclear factor 1 alpha (TCF1) 2 [Source:HGNC Symbol;Acc:24474] |
| Percent Identity: | 55.56 % |
| Parental protein coverage: | 76.56 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected | 1 |
| Parental | AAALRARGATLRLFGALRREDTRLAAMSADAHWLTAEERNQVILDLKAAGWSELSERNAIYKEFSFKNFN |
| AAAL.ARGAT.RLFG..R.....L.A.SADAH..T.EE......DLKAAGW..LSER..IY...SF.N.. | |
| Retrocopy | AAALGARGATWRLFGRSRAWPPILRAVSADAH*VTREE-EPGYKDLKAAGWQ*LSERGPIYTVSSFQNGV |
| Parental | QAFGFM-SRVALQAEKMNHHPEWFNVYNK |
| .A..FM...V.L..EKMNHH.E.FN...K | |
| Retrocopy | LALSFM>DQVSLPTEKMNHHQECFNIDTK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012922_ascending_colon | 0 .00 RPM | 5 .64 RPM |
| SRP012922_cerebellum | 0 .00 RPM | 3 .71 RPM |
| SRP012922_heart | 0 .00 RPM | 2 .78 RPM |
| SRP012922_kidney | 0 .00 RPM | 4 .65 RPM |
| SRP012922_liver | 0 .00 RPM | 4 .02 RPM |
| SRP012922_lung | 0 .00 RPM | 8 .25 RPM |
| SRP012922_quadricep_muscle | 0 .00 RPM | 8 .31 RPM |
| SRP012922_spleen | 0 .00 RPM | 6 .98 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Dasypus novemcinctus | ENSDNOG00000019125 | 2 retrocopies |
retro_dnov_645, retro_dnov_660 ,
|
| Equus caballus | ENSECAG00000015810 | 2 retrocopies | |
| Erinaceus europaeus | ENSEEUG00000007051 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000016658 | 2 retrocopies | |
| Macropus eugenii | ENSMEUG00000003784 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000012638 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000014351 | 1 retrocopy | |
| Pteropus vampyrus | ENSPVAG00000000384 | 2 retrocopies | |
| Tursiops truncatus | ENSTTRG00000016874 | 3 retrocopies |