RetrogeneDB ID: | retro_dnov_2332 | ||
Retrocopylocation | Organism: | Armadillo (Dasypus novemcinctus) | |
| Coordinates: | scaffold_65008:2640..2990(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | GABARAPL2 | ||
| Ensembl ID: | ENSDNOG00000002240 | ||
| Aliases: | None | ||
| Description: | GABA(A) receptor-associated protein-like 2 [Source:HGNC Symbol;Acc:13291] |
| Percent Identity: | 82.5 % |
| Parental protein coverage: | 100. % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 3 |
| Parental | MKWMFKEDH-SLEHRCVESAKIRA-KYPDRVPVIVEKVSGSQIVDIDKRKYLVPSDITVAQFMWIIRKRI |
| .KWM..EDH.S.E..CVESAKI.A..YPD.VPVIVEKVSGSQ.V.IDKRKY.VPSDITVAQFMWIIRKR. | |
| Retrocopy | LKWMCTEDH<SVE*GCVESAKIGA>QYPDQVPVIVEKVSGSQLVHIDKRKYVVPSDITVAQFMWIIRKRT |
| Parental | QLPSEKAIFLFVDKTVPQSSLTMGQLYEKEKDEDGFLYVAYS-GENTFGV |
| QLPSEKA.FLFVD.TVPQSSLT.GQLYEKEKDEDGF.YVAYS..ENTFGV | |
| Retrocopy | QLPSEKAVFLFVDRTVPQSSLTVGQLYEKEKDEDGFSYVAYS<QENTFGV |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012922_ascending_colon | 0 .00 RPM | 35 .39 RPM |
| SRP012922_cerebellum | 0 .00 RPM | 99 .80 RPM |
| SRP012922_heart | 0 .00 RPM | 48 .96 RPM |
| SRP012922_kidney | 0 .00 RPM | 65 .98 RPM |
| SRP012922_liver | 0 .00 RPM | 27 .25 RPM |
| SRP012922_lung | 0 .00 RPM | 73 .00 RPM |
| SRP012922_quadricep_muscle | 0 .00 RPM | 90 .18 RPM |
| SRP012922_spleen | 0 .00 RPM | 100 .15 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000005453 | 2 retrocopies | |
| Canis familiaris | ENSCAFG00000031455 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000014253 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000002240 | 2 retrocopies |
retro_dnov_1755, retro_dnov_2332 ,
|
| Dasypus novemcinctus | ENSDNOG00000010228 | 7 retrocopies | |
| Erinaceus europaeus | ENSEEUG00000011134 | 1 retrocopy | |
| Homo sapiens | ENSG00000034713 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000012299 | 2 retrocopies | |
| Loxodonta africana | ENSLAFG00000017065 | 2 retrocopies | |
| Microcebus murinus | ENSMICG00000011981 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000015112 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000005759 | 2 retrocopies | |
| Mustela putorius furo | ENSMPUG00000009894 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000031950 | 5 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000013048 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000007565 | 2 retrocopies | |
| Pan troglodytes | ENSPTRG00000008362 | 2 retrocopies | |
| Rattus norvegicus | ENSRNOG00000019425 | 1 retrocopy |