RetrogeneDB ID: | retro_mmul_2369 | ||
Retrocopylocation | Organism: | Rhesus macaque (Macaca mulatta) | |
| Coordinates: | 8:121502691..121503043(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | MMU.4321 | ||
| Ensembl ID: | ENSMMUG00000005759 | ||
| Aliases: | None | ||
| Description: | gamma-aminobutyric acid receptor-associated protein-like 2 [Source:RefSeq peptide;Acc:NP_001181193] |
| Percent Identity: | 71.67 % |
| Parental protein coverage: | 100. % |
| Number of stop codons detected: | 5 |
| Number of frameshifts detected | 2 |
| Parental | MKWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLVPSDITVAQFMWIIRKRIQL |
| .K.MFKE.HSLEHRC.ES.KI.A.YPD.V.VIVEKVSGSQ.V..D....L.P.D.TVAQ...IIRKRIQL | |
| Retrocopy | IK*MFKEEHSLEHRCIESSKI*AIYPDQVLVIVEKVSGSQVVNTDNQRKLGPVDATVAQLI*IIRKRIQL |
| Parental | PSEKAIFLFVDKTVPQSSLTMGQL-YEKEKDEDGFLYV-AYSGENT-FGF |
| PSEK.IFLFV.KTVP.SSLTMGQL...KEKDED.FLYV.AYS..N..FGF | |
| Retrocopy | PSEKEIFLFVNKTVP*SSLTMGQL<FQKEKDED*FLYVLAYSIWNI<FGF |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 84 .71 RPM |
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 90 .59 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 106 .35 RPM |
| SRP007412_heart | 0 .24 RPM | 58 .00 RPM |
| SRP007412_kidney | 0 .00 RPM | 50 .82 RPM |
| SRP007412_liver | 0 .00 RPM | 22 .17 RPM |
| SRP007412_testis | 0 .04 RPM | 26 .05 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_4115 |
| Pan troglodytes | retro_ptro_2794 |
| Pongo abelii | retro_pabe_3368 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000005453 | 2 retrocopies | |
| Callithrix jacchus | ENSCJAG00000014253 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000002240 | 2 retrocopies | |
| Homo sapiens | ENSG00000034713 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000012299 | 2 retrocopies | |
| Loxodonta africana | ENSLAFG00000017065 | 2 retrocopies | |
| Myotis lucifugus | ENSMLUG00000015112 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000002197 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000005759 | 2 retrocopies |
retro_mmul_2369 , retro_mmul_540,
|
| Macaca mulatta | ENSMMUG00000010545 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000017613 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000013048 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000007565 | 2 retrocopies | |
| Pan troglodytes | ENSPTRG00000008362 | 2 retrocopies | |
| Rattus norvegicus | ENSRNOG00000019425 | 1 retrocopy |