RetrogeneDB ID: | retro_mluc_1207 | ||
Retrocopylocation | Organism: | Microbat (Myotis lucifugus) | |
| Coordinates: | GL429807:406450..406693(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | GABARAPL2 | ||
| Ensembl ID: | ENSMLUG00000015112 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 86.42 % |
| Parental protein coverage: | 69.23 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 0 |
| Parental | MKWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLVPSDITVAQFMWIIRKRIQL |
| MKW.FKEDHSLEHRCVES.KI.AKYP.RVPV..EKVSGS...DIDKRKYLVPSDITVA.FMW.IRKRIQL | |
| Retrocopy | MKWVFKEDHSLEHRCVESPKI*AKYPNRVPVSMEKVSGSPAADIDKRKYLVPSDITVAPFMWNIRKRIQL |
| Parental | PSEKAIFLFVD |
| PSEKAIFLFVD | |
| Retrocopy | PSEKAIFLFVD |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000005453 | 2 retrocopies | |
| Callithrix jacchus | ENSCJAG00000014253 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000002240 | 2 retrocopies | |
| Homo sapiens | ENSG00000034713 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000012299 | 2 retrocopies | |
| Loxodonta africana | ENSLAFG00000017065 | 2 retrocopies | |
| Myotis lucifugus | ENSMLUG00000015112 | 1 retrocopy |
retro_mluc_1207 ,
|
| Myotis lucifugus | ENSMLUG00000015596 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000005759 | 2 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000013048 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000007565 | 2 retrocopies | |
| Pan troglodytes | ENSPTRG00000008362 | 2 retrocopies | |
| Rattus norvegicus | ENSRNOG00000019425 | 1 retrocopy |