RetrogeneDB ID: | retro_pabe_3368 | ||
Retrocopylocation | Organism: | Orangutan (Pongo abelii) | |
| Coordinates: | 8:126583053..126583406(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | GABARAPL2 | ||
| Ensembl ID: | ENSPPYG00000007565 | ||
| Aliases: | None | ||
| Description: | GABA(A) receptor-associated protein-like 2 [Source:HGNC Symbol;Acc:13291] |
| Percent Identity: | 68.07 % |
| Parental protein coverage: | 100. % |
| Number of stop codons detected: | 5 |
| Number of frameshifts detected | 1 |
| Parental | MKWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLVPSDITVAQFMWIIRKRIQL |
| .K.MFKE.HSLEHRC.ES.KI.AKYP..V.V.VE.VSGSQ.V..D....L.P.D.TVAQ...IIRKRIQL | |
| Retrocopy | IK*MFKEEHSLEHRCTESSKI*AKYPNQVLVVVENVSGSQVVNTDNQRKLGPVDATVAQLI*IIRKRIQL |
| Parental | PSEKAIFLFVDKTVPQSSLTMGQL-YEKEKDEDGFLYV-AYSGENTFGF |
| PSEK.IF.FV.KT.P.SSLTMGQL...KEKDED.FLYV.AYS..N..GF | |
| Retrocopy | PSEKEIFPFVNKTIP*SSLTMGQL<FQKEKDED*FLYVLAYSTWNILGF |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 72 .54 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 90 .96 RPM |
| SRP007412_heart | 0 .00 RPM | 44 .28 RPM |
| SRP007412_kidney | 0 .00 RPM | 39 .48 RPM |
| SRP007412_liver | 0 .00 RPM | 22 .46 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_4115 |
| Pan troglodytes | retro_ptro_2794 |
| Macaca mulatta | retro_mmul_2369 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000005453 | 2 retrocopies | |
| Callithrix jacchus | ENSCJAG00000014253 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000002240 | 2 retrocopies | |
| Homo sapiens | ENSG00000034713 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000012299 | 2 retrocopies | |
| Loxodonta africana | ENSLAFG00000017065 | 2 retrocopies | |
| Myotis lucifugus | ENSMLUG00000015112 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000005759 | 2 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000013048 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000007565 | 2 retrocopies |
retro_pabe_3368 , retro_pabe_372,
|
| Pongo abelii | ENSPPYG00000007628 | 7 retrocopies | |
| Pongo abelii | ENSPPYG00000007901 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000008362 | 2 retrocopies | |
| Rattus norvegicus | ENSRNOG00000019425 | 1 retrocopy |