RetrogeneDB ID: | retro_cpor_1013 | ||
Retrocopylocation | Organism: | Guinea Pig (Cavia porcellus) | |
| Coordinates: | scaffold_4:27735179..27735556(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSCPOG00000019917 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 79.53 % |
| Parental protein coverage: | 60.29 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected | 1 |
| Parental | MEGGGGSGNKTTGGLAGFFGAGGAG-YSHADLAGVPLTGMNPLSPYLNVDPRYLVQDTDEFILPTGANKT |
| MEG.GGS.NKTT.GL..FFGA.GA..YSHA.LAG..LTGM..LS.YLNV.P.YLVQDT.EFILPTGANKT | |
| Retrocopy | MEGSGGSSNKTTRGLVSFFGASGAV<YSHANLAGILLTGMSRLSHYLNVGP*YLVQDTNEFILPTGANKT |
| Parental | RGRFELAFFTIGGCCMTGAAFGAVNGLRLGLKETQNMAWSKPRNVQILNMVTRQGAL |
| .G.FELAFFTIGG.CM.GAAFG.VNGL.LGLKETQN.AWSKPRNVQILNMVTRQG.. | |
| Retrocopy | QGSFELAFFTIGGGCMIGAAFGTVNGL*LGLKETQNTAWSKPRNVQILNMVTRQGPI |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 17 .25 RPM |
| SRP017611_kidney | 0 .00 RPM | 32 .66 RPM |
| SRP017611_liver | 0 .00 RPM | 17 .67 RPM |
| SRP040447_lung | 0 .00 RPM | 14 .63 RPM |
| SRP040447_skeletal_muscle | 0 .00 RPM | 40 .36 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000007501 | 1 retrocopy | |
| Canis familiaris | ENSCAFG00000029477 | 1 retrocopy | |
| Choloepus hoffmanni | ENSCHOG00000007073 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000013336 | 1 retrocopy | |
| Cavia porcellus | ENSCPOG00000019917 | 2 retrocopies |
retro_cpor_1013 , retro_cpor_321,
|
| Monodelphis domestica | ENSMODG00000002661 | 2 retrocopies | |
| Mus musculus | ENSMUSG00000013701 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000000525 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000015393 | 1 retrocopy | |
| Ochotona princeps | ENSOPRG00000005255 | 2 retrocopies | |
| Procavia capensis | ENSPCAG00000015914 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000019811 | 3 retrocopies | |
| Sorex araneus | ENSSARG00000010335 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000025276 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000007041 | 1 retrocopy |