RetrogeneDB ID: | retro_btau_1129 | ||
Retrocopylocation | Organism: | Cow (Bos taurus) | |
| Coordinates: | 27:9792194..9792524(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | HINT2 | ||
| Ensembl ID: | ENSBTAG00000011444 | ||
| Aliases: | None | ||
| Description: | Histidine triad nucleotide-binding protein 2, mitochondrial [Source:UniProtKB/Swiss-Prot;Acc:Q8SQ21] |
| Percent Identity: | 55.45 % |
| Parental protein coverage: | 65.64 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 0 |
| Parental | AAAVVLAAGLCVARR---AVAVAGPRGVQVRGAAGVTDGDEVAKAQQAAPGGAAPTIFSRILDRSLPADI |
| A...VL..G.C.A......V...G..G.QVRGAAGVT....VA..Q...PG.AA.T.FS.ILDRSLP..I | |
| Retrocopy | AGWMVLPSGPCMATLGGGSVGTRGGEGAQVRGAAGVTHRSQVAEGQHTGPGAAALTVFSWILDRSLPSGI |
| Parental | LYEDQQCLAFRDVAPQAPVHFLVIPKKPIPRISQAEEEDQ |
| LYEDQ..L.F.DVAP.APV.FLVIPKK.I....Q.E...Q | |
| Retrocopy | LYEDQMFLTFCDVAP*APVLFLVIPKKSISQVNQVEDNQQ |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| ERP005899_liver | 0 .00 RPM | 27 .11 RPM |
| ERP005899_muscle | 0 .00 RPM | 51 .84 RPM |
| SRP017611_brain | 0 .00 RPM | 11 .28 RPM |
| SRP017611_kidney | 0 .00 RPM | 48 .01 RPM |
| SRP017611_liver | 0 .00 RPM | 33 .53 RPM |
| SRP030211_testis | 0 .00 RPM | 37 .36 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000010959 | 5 retrocopies | |
| Bos taurus | ENSBTAG00000011444 | 1 retrocopy |
retro_btau_1129 ,
|
| Callithrix jacchus | ENSCJAG00000010068 | 1 retrocopy | |
| Cavia porcellus | ENSCPOG00000000419 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000009083 | 2 retrocopies | |
| Echinops telfairi | ENSETEG00000017929 | 1 retrocopy | |
| Homo sapiens | ENSG00000137133 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000011265 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000015022 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000016337 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000026914 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000027206 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000011830 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000019082 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000020923 | 1 retrocopy | |
| Pteropus vampyrus | ENSPVAG00000003028 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000013020 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000002700 | 7 retrocopies | |
| Tursiops truncatus | ENSTTRG00000011932 | 1 retrocopy |