RetrogeneDB ID: | retro_ggor_1823 | ||
Retrocopylocation | Organism: | Gorilla (Gorilla gorilla) | |
| Coordinates: | 3:2440628..2441026(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | HINT2 | ||
| Ensembl ID: | ENSGGOG00000011265 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 75.37 % |
| Parental protein coverage: | 81.6 % |
| Number of stop codons detected: | 3 |
| Number of frameshifts detected | 1 |
| Parental | GAAGVTDGNEVAKAQQATPGGAAPTIFSRILDKSLPADILYEDQQCLVFRDVAPQAPVHFLVIPKKPIPR |
| GA.GVT.GNE..KAQ.A.PGG.APTI...ILD..LPA.ILYED.QCLVF..VAP.APVHF.VIPKKPIPR | |
| Retrocopy | GAVGVTGGNEMTKAQRAIPGGVAPTISCGILDHRLPACILYED*QCLVFPEVAP*APVHFPVIPKKPIPR |
| Parental | ISQAEEED-QQLLGHLLLVAKQTAKAEGLGDGYRLVINDGKLGAQSVYHLHIHVLGGRQLQWPP |
| I.QAEEED.QQLLGHLLLV.K..A.AEGLGDGY.L.IND.KLG.QSV..LHIH.LG..QLQWPP | |
| Retrocopy | INQAEEED<QQLLGHLLLVCKKIARAEGLGDGYQLEINDEKLGEQSVNYLHIHLLGS*QLQWPP |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 9 .49 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 8 .23 RPM |
| SRP007412_heart | 0 .00 RPM | 16 .85 RPM |
| SRP007412_kidney | 0 .00 RPM | 41 .09 RPM |
| SRP007412_liver | 0 .00 RPM | 44 .10 RPM |
| SRP007412_testis | 0 .00 RPM | 16 .89 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_2603 |
| Pan troglodytes | retro_ptro_1754 |
| Pongo abelii | retro_pabe_2310 |
| Macaca mulatta | retro_mmul_1509 |
| Callithrix jacchus | retro_cjac_1343 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000011444 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000010068 | 1 retrocopy | |
| Cavia porcellus | ENSCPOG00000000419 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000009083 | 2 retrocopies | |
| Echinops telfairi | ENSETEG00000017929 | 1 retrocopy | |
| Homo sapiens | ENSG00000137133 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000011265 | 1 retrocopy |
retro_ggor_1823 ,
|
| Gorilla gorilla | ENSGGOG00000011967 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000015022 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000016337 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000026914 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000027206 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000011830 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000019082 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000020923 | 1 retrocopy | |
| Pteropus vampyrus | ENSPVAG00000003028 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000013020 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000002700 | 7 retrocopies | |
| Tursiops truncatus | ENSTTRG00000011932 | 1 retrocopy |