RetrogeneDB ID: | retro_dnov_201 | ||
Retrocopylocation | Organism: | Armadillo (Dasypus novemcinctus) | |
| Coordinates: | GeneScaffold_256:8835..9207(+) | ||
| Located in intron of: | ENSDNOG00000003528 | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | HINT2 | ||
| Ensembl ID: | ENSDNOG00000009083 | ||
| Aliases: | None | ||
| Description: | histidine triad nucleotide binding protein 2 [Source:HGNC Symbol;Acc:18344] |
| Percent Identity: | 52.38 % |
| Parental protein coverage: | 92.65 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 0 |
| Parental | NEVAKAQQAAPGAAAPTIFSRILDRSLPADILYEDQQCLVFRDVAPQAPVHFLVIPKKPIPRISQAEEED |
| .E.AKAQ...PG....TIF..I.....P..I..ED.Q.L.F....PQA..HFLVIPKK.I..IS.A...D | |
| Retrocopy | DEIAKAQATPPGG--DTIFGKIIHKEIPTKIIFEDDQSLAFHNISPQASTHFLVIPKKHISQISVA*DDD |
| Parental | EQLLGHLLLVAKKAAKAEGLGDGYRLVINDGKLGAQSVYHLHIHVLGGRQLQWPPG |
| E..LGHL..V.KK.A...GL..GY..V.N.G..G.QSV...H.HVLGGRQ..WPPG | |
| Retrocopy | ERQLGHLMIVGKKCAADLGLKKGYGMVVNEGSEGGQSVCPVHLHVLGGRQMSWPPG |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012922_ascending_colon | 3 .89 RPM | 29 .75 RPM |
| SRP012922_cerebellum | 2 .61 RPM | 21 .58 RPM |
| SRP012922_heart | 2 .32 RPM | 30 .63 RPM |
| SRP012922_kidney | 16 .98 RPM | 134 .71 RPM |
| SRP012922_liver | 11 .46 RPM | 74 .93 RPM |
| SRP012922_lung | 4 .12 RPM | 50 .09 RPM |
| SRP012922_quadricep_muscle | 2 .77 RPM | 11 .60 RPM |
| SRP012922_spleen | 4 .58 RPM | 33 .31 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000011444 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000010068 | 1 retrocopy | |
| Cavia porcellus | ENSCPOG00000000419 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000009083 | 2 retrocopies |
retro_dnov_201 , retro_dnov_854,
|
| Echinops telfairi | ENSETEG00000017929 | 1 retrocopy | |
| Homo sapiens | ENSG00000137133 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000011265 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000015022 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000016337 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000026914 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000027206 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000011830 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000019082 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000020923 | 1 retrocopy | |
| Pteropus vampyrus | ENSPVAG00000003028 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000013020 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000002700 | 7 retrocopies | |
| Tursiops truncatus | ENSTTRG00000011932 | 1 retrocopy |