RetrogeneDB ID: | retro_btau_1036 | ||
Retrocopylocation | Organism: | Cow (Bos taurus) | |
| Coordinates: | 23:49810879..49811157(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | HINT1 | ||
| Ensembl ID: | ENSBTAG00000010959 | ||
| Aliases: | None | ||
| Description: | Histidine triad nucleotide-binding protein 1 [Source:UniProtKB/Swiss-Prot;Acc:P62958] |
| Percent Identity: | 69.15 % |
| Parental protein coverage: | 73.81 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 1 |
| Parental | MADEIAKAQVARPGGDTIFGKIIRKEIPAK-IIYEDDQCLAFHDISPQAPTHFLVIPKKYISQISAAEDD |
| MA.E..KAQ.A.PGGD...GKIIR.EIPAK...YE..Q.L.F.DISPQAPTHFLVI..K...QISA.ED. | |
| Retrocopy | MAGEFTKAQAAWPGGDMLSGKIIREEIPAK<VVYEEEQGLVFPDISPQAPTHFLVIFTKHKFQISATEDE |
| Parental | DESLLGHLMIVGKKCAADLGLKKG |
| DE.LLGHL.IVG.KCAA.LGLK.G | |
| Retrocopy | DERLLGHLIIVGWKCAAVLGLK*G |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| ERP005899_liver | 0 .00 RPM | 34 .97 RPM |
| ERP005899_muscle | 0 .00 RPM | 79 .71 RPM |
| SRP017611_brain | 0 .00 RPM | 21 .47 RPM |
| SRP017611_kidney | 0 .00 RPM | 71 .66 RPM |
| SRP017611_liver | 0 .00 RPM | 22 .43 RPM |
| SRP030211_testis | 0 .00 RPM | 39 .46 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000017774 | 4 retrocopies | |
| Bos taurus | ENSBTAG00000010959 | 5 retrocopies | |
| Bos taurus | ENSBTAG00000011444 | 1 retrocopy | |
| Canis familiaris | ENSCAFG00000032152 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000014398 | 3 retrocopies | |
| Echinops telfairi | ENSETEG00000010127 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000011967 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000005368 | 2 retrocopies | |
| Myotis lucifugus | ENSMLUG00000001091 | 2 retrocopies | |
| Monodelphis domestica | ENSMODG00000028727 | 3 retrocopies | |
| Mustela putorius furo | ENSMPUG00000011639 | 4 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000006607 | 5 retrocopies | |
| Rattus norvegicus | ENSRNOG00000000622 | 1 retrocopy | |
| Sarcophilus harrisii | ENSSHAG00000005834 | 2 retrocopies | |
| Sus scrofa | ENSSSCG00000014264 | 2 retrocopies | |
| Ictidomys tridecemlineatus | ENSSTOG00000027920 | 4 retrocopies | |
| Tursiops truncatus | ENSTTRG00000008653 | 4 retrocopies |