RetrogeneDB ID: | retro_vpac_531 | ||
Retrocopy location | Organism: | Alpaca (Vicugna pacos) | |
| Coordinates: | scaffold_33217:0..249(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | EIF1AX | ||
| Ensembl ID: | ENSVPAG00000009927 | ||
| Aliases: | None | ||
| Description: | eukaryotic translation initiation factor 1A, X-linked [Source:HGNC Symbol;Acc:3250] |
| Percent Identity: | 92.77 % |
| Parental protein coverage: | 59.85 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | KGGKNRRRGKNENESEKRELVFKEDGQEYAQVIKMLGNGRLEAMCFDGVKRLCHIRGKLRKKVWINTSDI |
| KGGKNRRRGKNEN.SEKRELVFK.DGQEYAQVIKMLGNGRLEA.CFDGVK.LCHIRGKLRKKVW.NTSDI | |
| Retrocopy | KGGKNRRRGKNENKSEKRELVFKADGQEYAQVIKMLGNGRLEALCFDGVKMLCHIRGKLRKKVWVNTSDI |
| Parental | ILVGLRD-QDNKA |
| ILVGLRD.QDNKA | |
| Retrocopy | ILVGLRDYQDNKA |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000017633 | 3 retrocopies | |
| Callithrix jacchus | ENSCJAG00000005371 | 1 retrocopy | |
| Erinaceus europaeus | ENSEEUG00000007518 | 3 retrocopies | |
| Homo sapiens | ENSG00000173674 | 2 retrocopies | |
| Myotis lucifugus | ENSMLUG00000012977 | 2 retrocopies | |
| Monodelphis domestica | ENSMODG00000027820 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000067194 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000008182 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000020176 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000022504 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000005736 | 1 retrocopy | |
| Sorex araneus | ENSSARG00000013528 | 1 retrocopy | |
| Sarcophilus harrisii | ENSSHAG00000010995 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000029864 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000002012 | 1 retrocopy | |
| Vicugna pacos | ENSVPAG00000009927 | 4 retrocopies |