RetrogeneDB ID: | retro_ttru_1465 | ||
Retrocopy location | Organism: | Dolphin (Tursiops truncatus) | |
| Coordinates: | scaffold_114093:167052..167301(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | POMP | ||
| Ensembl ID: | ENSTTRG00000012924 | ||
| Aliases: | None | ||
| Description: | proteasome maturation protein [Source:HGNC Symbol;Acc:20330] |
| Percent Identity: | 67.47 % |
| Parental protein coverage: | 58.87 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 0 |
| Parental | KNFQLNQDKMNFSTLRNIQGLFAPLKLQMEFKAVQQVQRLPFLPSSNLSLDILRGNDETIGFEDILNDPS |
| .N..LN..KMN.STLR.IQGLFA...L.MEF.AV..VQ.LPF.PSS.L.L..LRGNDE.IGF.DI.NDPS | |
| Retrocopy | QNKMLNGNKMNLSTLRTIQGLFALIELHMEFNAVEHVQYLPFFPSSDL*LNMLRGNDEAIGFQDIFNDPS |
| Parental | QSELMGEPHLMVE |
| Q...M.EPHLMVE | |
| Retrocopy | QNDVMKEPHLMVE |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |