RetrogeneDB ID: | retro_fcat_834 | ||
Retrocopy location | Organism: | Cat (Felis catus) | |
| Coordinates: | B3:49573654..49573884(+) | ||
| Located in intron of: | ENSFCAG00000031674 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | POMP | ||
| Ensembl ID: | ENSFCAG00000008235 | ||
| Aliases: | None | ||
| Description: | proteasome maturation protein [Source:HGNC Symbol;Acc:20330] |
| Percent Identity: | 74.68 % |
| Parental protein coverage: | 54.61 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 2 |
| Parental | NARGLGSQLKDSIPVTELSASGPFESHDLL-RKGLPCVKNE-LLPSHPLELLFKGFQLNQDKMNFSTLRN |
| .ARGLGSQLKDSIPVTELS.SGPFESHDLL..KG.P..KN..LL.S.PLEL..K.FQL..DKM.FSTLR. | |
| Retrocopy | DARGLGSQLKDSIPVTELSVSGPFESHDLL>KKGFPRIKND>LL-SYPLELSKKNFQLK*DKMTFSTLRH |
| Parental | IQGLFAPLK |
| IQGL.APL. | |
| Retrocopy | IQGLCAPLE |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 28 .92 RPM |
| SRP017611_kidney | 0 .00 RPM | 33 .60 RPM |
| SRP017611_liver | 0 .00 RPM | 24 .97 RPM |