RetrogeneDB ID: | retro_rnor_2600 | ||
Retrocopy location | Organism: | Rat (Rattus norvegicus) | |
| Coordinates: | 8:131974123..131974347(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | RGD1565641 | ||
| Ensembl ID: | ENSRNOG00000038902 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 52.63 % |
| Parental protein coverage: | 77.32 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 1 |
| Parental | HIASHKPLKAKNKAKPVTTNLKKINIMNHEK-VNRMNRAFVNIQKELANFSKSLSLKSVQKELKHHEKEP |
| .I....P..........TTNLKKI..M..EK.VNR.N..FVN.QKEL.NFSK..S.KSVQKE..H.E.E. | |
| Retrocopy | YISHSQPNILQS*KQDKTTNLKKIIVMRNEK<VNRINKVFVNMQKELVNFSKGFSFKSVQKEPLHRENEL |
| Parental | ANVDEA |
| .N.D.A | |
| Retrocopy | VNPDQA |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 3 .88 RPM |
| SRP017611_kidney | 0 .00 RPM | 7 .89 RPM |
| SRP017611_liver | 0 .00 RPM | 6 .59 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Mus musculus | retro_mmus_3313 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000002409 | 2 retrocopies | |
| Bos taurus | ENSBTAG00000032227 | 2 retrocopies | |
| Callithrix jacchus | ENSCJAG00000000379 | 5 retrocopies | |
| Cavia porcellus | ENSCPOG00000021965 | 5 retrocopies | |
| Felis catus | ENSFCAG00000026366 | 1 retrocopy | |
| Homo sapiens | ENSG00000176731 | 4 retrocopies | |
| Gorilla gorilla | ENSGGOG00000027464 | 4 retrocopies | |
| Loxodonta africana | ENSLAFG00000032612 | 4 retrocopies | |
| Myotis lucifugus | ENSMLUG00000006155 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000006381 | 3 retrocopies | |
| Mus musculus | ENSMUSG00000078784 | 3 retrocopies | |
| Pongo abelii | ENSPPYG00000029910 | 3 retrocopies | |
| Pan troglodytes | ENSPTRG00000020385 | 5 retrocopies | |
| Rattus norvegicus | ENSRNOG00000038902 | 2 retrocopies |
retro_rnor_2600 , retro_rnor_496,
|
| Sus scrofa | ENSSSCG00000006144 | 2 retrocopies |