RetrogeneDB ID: | retro_lafr_911 | ||
Retrocopy location | Organism: | Elephant (Loxodonta africana) | |
| Coordinates: | scaffold_49:1193860..1194167(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSLAFG00000032612 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 61.32 % |
| Parental protein coverage: | 97.12 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 2 |
| Parental | KTKTMAKNKLRGQKSRNVFHIASQKNFKSKNKAKPVTTNLKKINIVNDEKVN-RVNKAFVDIQKELAHFS |
| ..KTMAK.KL..Q.SR...HIASQ....S.NK..PVT..L.KIN.VNDEKVN.R.NKAFVD.QKEL.HFS | |
| Retrocopy | ESKTMAKKKLQWQESRKAGHIASQ-DVRSRNKVMPVTAGLQKINTVNDEKVN<RGNKAFVDEQKELTHFS |
| Parental | KGLTLEPLQKQL---QHQENEPV-NVDEATRLMAQL |
| K.L.LEPLQK.L...Q..E..P....D.ATRL.A.L | |
| Retrocopy | KRLSLEPLQK*LIPQQLHEENPL<DADKATRLRAPL |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000002409 | 2 retrocopies | |
| Bos taurus | ENSBTAG00000032227 | 2 retrocopies | |
| Callithrix jacchus | ENSCJAG00000000379 | 5 retrocopies | |
| Cavia porcellus | ENSCPOG00000021965 | 5 retrocopies | |
| Felis catus | ENSFCAG00000026366 | 1 retrocopy | |
| Homo sapiens | ENSG00000176731 | 4 retrocopies | |
| Gorilla gorilla | ENSGGOG00000027464 | 4 retrocopies | |
| Loxodonta africana | ENSLAFG00000032612 | 4 retrocopies | |
| Myotis lucifugus | ENSMLUG00000006155 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000006381 | 3 retrocopies | |
| Mus musculus | ENSMUSG00000078784 | 3 retrocopies | |
| Pongo abelii | ENSPPYG00000029910 | 3 retrocopies | |
| Pan troglodytes | ENSPTRG00000020385 | 5 retrocopies | |
| Rattus norvegicus | ENSRNOG00000038902 | 2 retrocopies | |
| Sus scrofa | ENSSSCG00000006144 | 2 retrocopies |