RetrogeneDB ID: | retro_rnor_2284 | ||
Retrocopy location | Organism: | Rat (Rattus norvegicus) | |
| Coordinates: | 6:46891155..46891532(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | Mrps10 | ||
| Ensembl ID: | ENSRNOG00000022609 | ||
| Aliases: | None | ||
| Description: | 28S ribosomal protein S10, mitochondrial [Source:UniProtKB/Swiss-Prot;Acc:Q7TQ82] |
| Percent Identity: | 84.25 % |
| Parental protein coverage: | 81.29 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 1 |
| Parental | LSILVKAHDKAVLDSYEYFAVLAAKELGLSIKVHEPPRKI-ERFTLLKSVHIFKKHRVQYEMRTLYRCLE |
| .S.LVK.HDKAVLDS.EYFAVLAAKELG.SIKV.EPPRK..E.FTLLKSVHIFKKHRVQYEMR.LYRCLE | |
| Retrocopy | MSVLVKVHDKAVLDSSEYFAVLAAKELGISIKVDEPPRKM<ECFTLLKSVHIFKKHRVQYEMRMLYRCLE |
| Parental | LKHLTGCTANVYLEYIQRNLPEGVAMEVTKTQIQQLPEHIKEPMWETVSGEKEETKS |
| LKHLTGCTAN.YLEYIQRNLPEGVA.EV.K..IQQLPE..KEPMWETVS.EKEE.K. | |
| Retrocopy | LKHLTGCTANIYLEYIQRNLPEGVATEVIKS*IQQLPEDSKEPMWETVSEEKEESKA |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 5 .10 RPM |
| SRP017611_kidney | 0 .00 RPM | 6 .42 RPM |
| SRP017611_liver | 0 .00 RPM | 3 .70 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Canis familiaris | ENSCAFG00000001638 | 1 retrocopy | |
| Choloepus hoffmanni | ENSCHOG00000006109 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000006067 | 1 retrocopy | |
| Dipodomys ordii | ENSDORG00000002081 | 1 retrocopy | |
| Homo sapiens | ENSG00000048544 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000012808 | 1 retrocopy | |
| Microcebus murinus | ENSMICG00000011379 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000014661 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000034729 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000004800 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000016697 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000016613 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000018169 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000022609 | 1 retrocopy |
retro_rnor_2284 ,
|
| Ictidomys tridecemlineatus | ENSSTOG00000027016 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000014063 | 1 retrocopy |