RetrogeneDB ID: | retro_ocun_1141 | ||
Retrocopy location | Organism: | Rabbit (Oryctolagus cuniculus) | |
| Coordinates: | 20:9894203..9894600(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | MRPS10 | ||
| Ensembl ID: | ENSOCUG00000016697 | ||
| Aliases: | None | ||
| Description: | mitochondrial ribosomal protein S10 [Source:HGNC Symbol;Acc:14502] |
| Percent Identity: | 56.12 % |
| Parental protein coverage: | 66.67 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 5 |
| Parental | ITVSDEP-DTLYKRLSILVKGHDKAVLD-SYEYFAVLAAKELGITIKVHEPPRKIERFTLLKSVHIFKKH |
| .T.SD...DTL.K.LSILVK.H.K..LD..Y..FAVL.AK.LGI...VHEPPRK.E.FT..KS..I...H | |
| Retrocopy | VTTSDDK<DTLHKQLSILVKRHEKTALD<HYGHFAVLVAKGLGIFTEVHEPPRKTEQFTVFKSACISQEH |
| Parental | RVQYEMRTLYRC-LELERLTG-STADVYLEYIQRNL-PEGVAMEVTKTHLERLPEHIKEPIWETVPEEK |
| R...EMRTL.RC......LTG.STA.V..E.IQ..L..EGVAMEV.KT..E..PEH..EP.WE..P... | |
| Retrocopy | RAGCEMRTLHRC<FPVRTLTG<STAGVLSENIQ*SL<AEGVAMEVIKTQAELVPEHSEEPTWEMIPSPR |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 45 .09 RPM |
| SRP017611_kidney | 0 .00 RPM | 24 .63 RPM |
| SRP017611_liver | 0 .00 RPM | 13 .33 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Dipodomys ordii | ENSDORG00000002081 | 1 retrocopy | |
| Homo sapiens | ENSG00000048544 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000012808 | 1 retrocopy | |
| Microcebus murinus | ENSMICG00000011379 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000014661 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000034729 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000004800 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000016697 | 1 retrocopy |
retro_ocun_1141 ,
|
| Pongo abelii | ENSPPYG00000016613 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000018169 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000022609 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000027016 | 1 retrocopy |