RetrogeneDB ID: | retro_rnor_1708 | ||
Retrocopy location | Organism: | Rat (Rattus norvegicus) | |
| Coordinates: | 2:262982072..262982315(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | Nme2 | ||
| Ensembl ID: | ENSRNOG00000002671 | ||
| Aliases: | Nme2, NDKB, nm23-2, p18-12d | ||
| Description: | Nucleoside diphosphate kinase B [Source:UniProtKB/Swiss-Prot;Acc:P19804] |
| Percent Identity: | 65.85 % |
| Parental protein coverage: | 53.95 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 0 |
| Parental | VKYMNSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVESAEKEIGLWF |
| .KYMNS.P....VWEGL...K.GRVMLGETN..DSKPGT..G.FCIQVG..IIHGSDSV.SA.KE..L.F | |
| Retrocopy | MKYMNSEPMRVTVWEGLSREKRGRVMLGETNLDDSKPGTNHGNFCIQVGGDIIHGSDSVDSA-KEMCLLF |
| Parental | KPEELIDYKSCA |
| KPEE.I....C. | |
| Retrocopy | KPEEPIG*VLCS |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 76 .86 RPM |
| SRP017611_kidney | 0 .00 RPM | 163 .92 RPM |
| SRP017611_liver | 0 .00 RPM | 72 .08 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Mus musculus | retro_mmus_221 |