RetrogeneDB ID: | retro_fcat_216 | ||
Retrocopy location | Organism: | Cat (Felis catus) | |
| Coordinates: | A1:2830065..2830451(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSFCAG00000006742 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 51.82 % |
| Parental protein coverage: | 87.5 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 4 |
| Parental | MANSERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKLIQASEELLKQHYIDLKDRPFFPGLVKYMNS |
| MA..E..F.A.KPD....G..GEIIK.F.QK....V..K..QASE.LL..H.IDL.DR......VK.M.. | |
| Retrocopy | MASGEGIFVAVKPDEARWGFRGEIIKHFQQKRSCRVSLKFMQASEDLLEEHCIDLNDRLYLADTVKRMHT |
| Parental | G-PVVAMVWEGLNVVKTGRVMLGET-NPADSKPGTIRGDFCIQVGR-NIIHGSDS-VKSAEKEISLW |
| G.P...MV.EGL.VVKTG.VML.ET..PA.SK..T..G.F.....R.NIIHG..S....AE.EI.LW | |
| Retrocopy | G<PAAVMV*EGLRVVKTGQVMLQET<SPANSKAST--GLFASKLAR<NIIHGNNS<LENAE-EIGLW |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 34 .20 RPM |
| SRP017611_kidney | 0 .00 RPM | 64 .62 RPM |
| SRP017611_liver | 0 .00 RPM | 32 .65 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000008022 | 3 retrocopies | |
| Bos taurus | ENSBTAG00000047186 | 1 retrocopy | |
| Equus caballus | ENSECAG00000021658 | 1 retrocopy | |
| Erinaceus europaeus | ENSEEUG00000003783 | 2 retrocopies | |
| Felis catus | ENSFCAG00000006742 | 5 retrocopies | |
| Felis catus | ENSFCAG00000008300 | 3 retrocopies | |
| Homo sapiens | ENSG00000011052 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000007784 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000016929 | 3 retrocopies | |
| Macaca mulatta | ENSMMUG00000001940 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000015573 | 4 retrocopies | |
| Mus musculus | ENSMUSG00000020857 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000002671 | 8 retrocopies | |
| Sus scrofa | ENSSSCG00000017591 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000013053 | 6 retrocopies | |
| Tursiops truncatus | ENSTTRG00000007433 | 1 retrocopy |