RetrogeneDB ID: | retro_mmul_1827 | ||
Retrocopy location | Organism: | Rhesus macaque (Macaca mulatta) | |
| Coordinates: | 4:29845315..29845772(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | ENSMMUG00000011686 | |
| Aliases: | None | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | MMU.3162 | ||
| Ensembl ID: | ENSMMUG00000001940 | ||
| Aliases: | None | ||
| Description: | nucleoside diphosphate kinase A [Source:RefSeq peptide;Acc:NP_001191444] |
| Percent Identity: | 92.81 % |
| Parental protein coverage: | 100.0 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | MANCERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGLKFMQASEDLLKEHYIDLKDRPFFAGLVKYMHS |
| MANCERTFIAIKPD.VQRGLVGEIIK.FEQKGFRLVGLKFM.ASEDLLKEHYIDLK.RPFF.GLVKYMHS | |
| Retrocopy | MANCERTFIAIKPDRVQRGLVGEIIKHFEQKGFRLVGLKFMPASEDLLKEHYIDLKGRPFFVGLVKYMHS |
| Parental | -GPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVESAEKEISLWFHPEEL |
| .GPVVAMVWEGLNVVKTGRVMLGETN.ADSKPGTI.GDFCIQVGRNIIHGSDSVESAE.EISLWFHPEEL | |
| Retrocopy | >GPVVAMVWEGLNVVKTGRVMLGETNSADSKPGTIHGDFCIQVGRNIIHGSDSVESAENEISLWFHPEEL |
| Parental | VDYMSCAQNWIYE |
| VDY.SC.QNWIYE | |
| Retrocopy | VDYTSCVQNWIYE |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .11 RPM | 110 .03 RPM |
| SRP007412_brain_prefrontal_cortex | 0 .79 RPM | 170 .24 RPM |
| SRP007412_cerebellum | 0 .58 RPM | 60 .57 RPM |
| SRP007412_heart | 0 .12 RPM | 158 .40 RPM |
| SRP007412_kidney | 0 .12 RPM | 159 .03 RPM |
| SRP007412_liver | 0 .36 RPM | 140 .72 RPM |
| SRP007412_testis | 0 .38 RPM | 30 .23 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000008022 | 3 retrocopies | |
| Bos taurus | ENSBTAG00000047186 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000018395 | 5 retrocopies | |
| Equus caballus | ENSECAG00000021658 | 1 retrocopy | |
| Erinaceus europaeus | ENSEEUG00000003783 | 2 retrocopies | |
| Felis catus | ENSFCAG00000006742 | 5 retrocopies | |
| Homo sapiens | ENSG00000011052 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000007784 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000016929 | 3 retrocopies | |
| Macaca mulatta | ENSMMUG00000000612 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000001940 | 1 retrocopy |
retro_mmul_1827 ,
|
| Monodelphis domestica | ENSMODG00000012580 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000015573 | 4 retrocopies | |
| Rattus norvegicus | ENSRNOG00000002671 | 8 retrocopies | |
| Sarcophilus harrisii | ENSSHAG00000014470 | 3 retrocopies | |
| Sus scrofa | ENSSSCG00000017591 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000013053 | 6 retrocopies | |
| Tursiops truncatus | ENSTTRG00000007433 | 1 retrocopy |