RetrogeneDB ID: | retro_ptro_947 | ||
Retrocopy location | Organism: | Chimpanzee (Pan troglodytes) | |
| Coordinates: | 14:102849307..102849552(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | NDUFB4 | ||
| Ensembl ID: | ENSPTRG00000015270 | ||
| Aliases: | None | ||
| Description: | Pan troglodytes NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 4, 15kDa (NDUFB4), nuclear gene encoding mitochondrial protein, mRNA. [Source:RefSeq mRNA;Acc:NM_001071792] |
| Percent Identity: | 57.83 % |
| Parental protein coverage: | 63.57 % |
| Number of stop codons detected: | 3 |
| Number of frameshifts detected: | 1 |
| Parental | LLQYNDPNRRG-LIENPALLRWAYARTINVYPNFRPTPKNSLMGALCGFGPLIFIYYIIKTERDRKEKLI |
| LLQ...PNR.G.LI...A......AR...VY.NFR.TP.NSL.GALCG.GP..F.YY..KT.RD.KEKLI | |
| Retrocopy | LLQCHQPNRQG<LIKDAAQMH*T*ARSAKVYLNFRLTPRNSLLGALCGIGPPFFWYYVFKTDRDMKEKLI |
| Parental | QEGKLDRTFHLSY |
| QE.KL..TF..S. | |
| Retrocopy | QERKLG*TFNISF |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .18 RPM | 42 .36 RPM |
| SRP007412_cerebellum | 0 .07 RPM | 28 .93 RPM |
| SRP007412_heart | 0 .06 RPM | 78 .14 RPM |
| SRP007412_kidney | 1 .39 RPM | 50 .11 RPM |
| SRP007412_liver | 0 .03 RPM | 27 .33 RPM |
| SRP007412_testis | 0 .11 RPM | 28 .88 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_1378 |