RetrogeneDB ID: | retro_ptro_2837 | ||
Retrocopy location | Organism: | Chimpanzee (Pan troglodytes) | |
| Coordinates: | 9:76858554..76858789(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | CKS2 | ||
| Ensembl ID: | ENSPTRG00000021093 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 83.95 % |
| Parental protein coverage: | 100.0 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 2 |
| Parental | MAHKQ-IYYSDKYFDEHYEYRHVMLPRELSKQVPKTHLMSEEEWRRL-GVQQSLGWVHYMIHEPEPHILL |
| .AHK..IY.SDKYFDEHY.YRHVMLPRELSKQ.P.THLMSEEEWRRL..VQ..LG.VHYMIHEPEPHILL | |
| Retrocopy | IAHKP<IYCSDKYFDEHYKYRHVMLPRELSKQAPETHLMSEEEWRRL<CVQWRLGRVHYMIHEPEPHILL |
| Parental | FRRPLPKDQQK |
| FR.PLPKDQQK | |
| Retrocopy | FRGPLPKDQQK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 4 .95 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 2 .72 RPM |
| SRP007412_heart | 0 .00 RPM | 2 .62 RPM |
| SRP007412_kidney | 0 .08 RPM | 5 .88 RPM |
| SRP007412_liver | 0 .00 RPM | 4 .26 RPM |
| SRP007412_testis | 0 .00 RPM | 55 .96 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_4183 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Canis familiaris | ENSCAFG00000002194 | 2 retrocopies | |
| Callithrix jacchus | ENSCJAG00000007792 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000009427 | 8 retrocopies | |
| Erinaceus europaeus | ENSEEUG00000004384 | 7 retrocopies | |
| Echinops telfairi | ENSETEG00000001260 | 10 retrocopies | |
| Felis catus | ENSFCAG00000022286 | 1 retrocopy | |
| Homo sapiens | ENSG00000123975 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000062248 | 4 retrocopies | |
| Ochotona princeps | ENSOPRG00000007583 | 3 retrocopies | |
| Pongo abelii | ENSPPYG00000025843 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000001398 | 4 retrocopies | |
| Pan troglodytes | ENSPTRG00000021093 | 1 retrocopy |
retro_ptro_2837 ,
|
| Rattus norvegicus | ENSRNOG00000014130 | 5 retrocopies | |
| Sorex araneus | ENSSARG00000002443 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000000048 | 7 retrocopies |