RetrogeneDB ID: | retro_etel_1839 | ||
Retrocopy location | Organism: | Lesser hedgehog tenrec (Echinops telfairi) | |
| Coordinates: | scaffold_305787:1964..2193(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | CKS2 | ||
| Ensembl ID: | ENSETEG00000001260 | ||
| Aliases: | None | ||
| Description: | CDC28 protein kinase regulatory subunit 2 [Source:HGNC Symbol;Acc:2000] |
| Percent Identity: | 55.7 % |
| Parental protein coverage: | 97.47 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 2 |
| Parental | HKQIYYSDKYFDEHY-EYRHVMLPRELSKQVPKTHLMSEEEWRRLGVQQSL-GWVHYMIHEPEPHILLFR |
| HKQ.Y.SDKYF.EH..E.....LP..L.KQ.P.THL.SEE..R.L..Q..L....HY...EP..HILLFR | |
| Retrocopy | HKQMYFSDKYFAEHV<EHWLATLPKGLYKQAPQTHLGSEEQ*RGLHFQKDL<DCIHYLTREPDLHILLFR |
| Parental | RPLPKEQQK |
| ..LPKEQ.K | |
| Retrocopy | QALPKEQ*K |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |