RetrogeneDB ID: | retro_cfam_1495 | ||
Retrocopy location | Organism: | Dog (Canis familiaris) | |
| Coordinates: | 32:11893827..11894063(-) | ||
| Located in intron of: | ENSCAFG00000023804 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | CKS2 | ||
| Ensembl ID: | ENSCAFG00000002194 | ||
| Aliases: | None | ||
| Description: | CDC28 protein kinase regulatory subunit 2 [Source:HGNC Symbol;Acc:2000] |
| Percent Identity: | 88.75 % |
| Parental protein coverage: | 100.0 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 1 |
| Parental | MAHKQIYYSDKYFDEHYEYRHVMLPRELSKQVPKTHLMSEEEWRRL-GVQQSLGWVHYMIHEPEPHILLF |
| MAHKQIYYSDKYFDEHY.Y.HVMLPRELSKQV.KTHLMSEE.WRRL..VQQSLG.VHYMIHEPEPH.LLF | |
| Retrocopy | MAHKQIYYSDKYFDEHYKYWHVMLPRELSKQVLKTHLMSEEAWRRL<YVQQSLGCVHYMIHEPEPHFLLF |
| Parental | RRPLPKEQQK |
| R.PLPKEQQK | |
| Retrocopy | R*PLPKEQQK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012049_cerebellum | 0 .00 RPM | 14 .78 RPM |
| SRP017611_brain | 0 .00 RPM | 5 .00 RPM |
| SRP017611_kidney | 0 .00 RPM | 13 .34 RPM |
| SRP017611_liver | 0 .00 RPM | 1 .60 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Canis familiaris | ENSCAFG00000002194 | 2 retrocopies |
retro_cfam_1495 , retro_cfam_472,
|
| Callithrix jacchus | ENSCJAG00000007792 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000009427 | 8 retrocopies | |
| Erinaceus europaeus | ENSEEUG00000004384 | 7 retrocopies | |
| Echinops telfairi | ENSETEG00000001260 | 10 retrocopies | |
| Homo sapiens | ENSG00000123975 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000012534 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000008729 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000028843 | 1 retrocopy | |
| Ochotona princeps | ENSOPRG00000007583 | 3 retrocopies | |
| Pongo abelii | ENSPPYG00000025843 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000021093 | 1 retrocopy | |
| Pteropus vampyrus | ENSPVAG00000011011 | 3 retrocopies | |
| Rattus norvegicus | ENSRNOG00000014130 | 5 retrocopies | |
| Sorex araneus | ENSSARG00000002443 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000021161 | 2 retrocopies |