RetrogeneDB ID: | retro_ptro_1594 | ||
Retrocopy location | Organism: | Chimpanzee (Pan troglodytes) | |
| Coordinates: | 2A:43357389..43357613(-) | ||
| Located in intron of: | ENSPTRG00000011867 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | MYCBP | ||
| Ensembl ID: | ENSPTRG00000000565 | ||
| Aliases: | None | ||
| Description: | MYC binding protein [Source:HGNC Symbol;Acc:7554] |
| Percent Identity: | 60.53 % |
| Parental protein coverage: | 72.82 % |
| Number of stop codons detected: | 3 |
| Number of frameshifts detected: | 1 |
| Parental | HYKAADSKREQFRRYLEKSGVLDTLTKVLVALYE-EPEKPNSALDFLKHHLGAATPENPEIELLRLELAE |
| HY........Q....LE....L...TKVLVAL...EPEKPN.A..FLKHHLG.A.PENPEIELL.LEL.E | |
| Retrocopy | HYGPLEHC*LQDQAILEVLRALGC*TKVLVALEK<EPEKPNTA*VFLKHHLGVAIPENPEIELLPLELTE |
| Parental | MKEKYE |
| MK.KYE | |
| Retrocopy | MKDKYE |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .04 RPM | 3 .81 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 6 .31 RPM |
| SRP007412_heart | 0 .00 RPM | 6 .70 RPM |
| SRP007412_kidney | 0 .00 RPM | 22 .33 RPM |
| SRP007412_liver | 0 .00 RPM | 7 .07 RPM |
| SRP007412_testis | 0 .00 RPM | 29 .72 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Gorilla gorilla | retro_ggor_1678 |