RetrogeneDB ID: | retro_ocun_979 | ||
Retrocopy location | Organism: | Rabbit (Oryctolagus cuniculus) | |
| Coordinates: | 18:50074729..50074942(+) | ||
| Located in intron of: | ENSOCUG00000002776 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | MYCBP | ||
| Ensembl ID: | ENSOCUG00000022203 | ||
| Aliases: | None | ||
| Description: | MYC binding protein [Source:HGNC Symbol;Acc:7554] |
| Percent Identity: | 76.06 % |
| Parental protein coverage: | 56.35 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 0 |
| Parental | MSSAGRSPPATVSGASDAAAAVTMAHYKAADSKREQFRRYLEKSGVLDTLTKVLVALYEEPEKPNSALDF |
| MSS...SPPA.VS.ASD..AAVTMAHYKA.D...EQF.R.LEKSGVLDTLTKVL.AL.EEPEKPNSAL.. | |
| Retrocopy | MSSTTWSPPAMVSSASDNTAAVTMAHYKANDLTQEQFQR*LEKSGVLDTLTKVLAALHEEPEKPNSALNL |
| Parental | L |
| L | |
| Retrocopy | L |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 2 .26 RPM |
| SRP017611_kidney | 0 .00 RPM | 9 .22 RPM |
| SRP017611_liver | 0 .00 RPM | 3 .31 RPM |