RetrogeneDB ID: | retro_ptro_1209 | ||
Retrocopy location | Organism: | Chimpanzee (Pan troglodytes) | |
| Coordinates: | 17:8882517..8882733(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | COX6B1 | ||
| Ensembl ID: | ENSPTRG00000010854 | ||
| Aliases: | None | ||
| Description: | Cytochrome c oxidase subunit VIb polypeptide 1 (Ubiquitous) [Source:UniProtKB/TrEMBL;Acc:K7CTL6] |
| Percent Identity: | 68.06 % |
| Parental protein coverage: | 80.9 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | YKTAPFDSRFPNQNQTRNCWQNYLDFHRCQKAMTAKGGDISVCEWYQRVYQSLCPTSWVTDWDEQRAEGT |
| YKTA.FDS.FPNQNQ.RNC.Q.YLDFH.C.KA..AKG....VCEWYQ.VY.SL.P.SWV..WD...AE.T | |
| Retrocopy | YKTALFDSSFPNQNQPRNCLQDYLDFHLCEKAVIAKGDNVFVCEWYQPVYKSLIPISWVSAWDDHWAEAT |
| Parental | FP |
| FP | |
| Retrocopy | FP |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 105 .24 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 32 .23 RPM |
| SRP007412_heart | 0 .00 RPM | 100 .26 RPM |
| SRP007412_kidney | 0 .00 RPM | 133 .19 RPM |
| SRP007412_liver | 0 .00 RPM | 52 .64 RPM |
| SRP007412_testis | 0 .00 RPM | 18 .55 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_1762 |
| Macaca mulatta | retro_mmul_1227 |