RetrogeneDB ID: | retro_fcat_758 | ||
Retrocopy location | Organism: | Cat (Felis catus) | |
| Coordinates: | B2:65674324..65674545(-) | ||
| Located in intron of: | ENSFCAG00000010488 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSFCAG00000006378 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 61.33 % |
| Parental protein coverage: | 85.06 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 1 |
| Parental | YQTAPFDSRFPNQNQTRNCWQNYLDFHRCEKAMTAKGGDVSVCEWYRRV-YKSLCPISWWVAAWDDRRAE |
| YQTAPFDS.FPNQNQTR..WQN.L.FH.CEK.MTA.G.DVS......RV......P.SW....WDD..A. | |
| Retrocopy | YQTAPFDSHFPNQNQTRSRWQNCLSFHHCEKTMTARGDDVSIYKIVLRV<VYTIRPVSWG*SPWDDGLAL |
| Parental | GTFPG |
| GTFPG | |
| Retrocopy | GTFPG |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 58 .53 RPM |
| SRP017611_kidney | 0 .00 RPM | 91 .00 RPM |
| SRP017611_liver | 0 .00 RPM | 34 .57 RPM |